aboutsummaryrefslogtreecommitdiffstats
path: root/epan/dissectors/packet-infiniband.h
diff options
context:
space:
mode:
Diffstat (limited to 'epan/dissectors/packet-infiniband.h')
-rw-r--r--epan/dissectors/packet-infiniband.h2574
1 files changed, 2574 insertions, 0 deletions
diff --git a/epan/dissectors/packet-infiniband.h b/epan/dissectors/packet-infiniband.h
new file mode 100644
index 0000000000..76c61d6140
--- /dev/null
+++ b/epan/dissectors/packet-infiniband.h
@@ -0,0 +1,2574 @@
+/* packet-infiniband.h
+ * Routines for Infiniband/ERF Dissection
+ * Copyright 2008 Endace Technology Limited
+ *
+ * $Id$
+ *
+ * Wireshark - Network traffic analyzer
+ * By Gerald Combs <gerald@wireshark.org>
+ * Copyright 1998 Gerald Combs
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation; either version 2
+ * of the License, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with this program; if not, write to the Free Software
+ * Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.
+ */
+#ifndef __PACKET_INFINIBAND_H_
+#define __PACKET_INFINIBAND_H_
+
+#define PROTO_TAG_INFINIBAND "Infiniband"
+
+#include <epan/etypes.h>
+
+/* Wireshark ID */
+static int proto_infiniband = -1;
+
+/* Variables to hold expansion values between packets */
+static gint ett_infiniband = -1;
+static gint ett_all_headers = -1;
+static gint ett_lrh = -1;
+static gint ett_grh = -1;
+static gint ett_bth = -1;
+static gint ett_rwh = -1;
+static gint ett_rawdata = -1;
+static gint ett_rdeth = -1;
+static gint ett_deth = -1;
+static gint ett_reth = -1;
+static gint ett_atomiceth = -1;
+static gint ett_aeth = -1;
+static gint ett_atomicacketh = -1;
+static gint ett_immdt = -1;
+static gint ett_ieth = -1;
+static gint ett_payload = -1;
+static gint ett_vendor = -1;
+static gint ett_subn_lid_routed = -1;
+static gint ett_subn_directed_route = -1;
+static gint ett_subnadmin = -1;
+static gint ett_mad = -1;
+static gint ett_rmpp = -1;
+static gint ett_subm_attribute = -1;
+static gint ett_suba_attribute = -1;
+static gint ett_datadetails = -1;
+static gint ett_noticestraps = -1;
+static gint ett_nodedesc = -1;
+static gint ett_nodeinfo = -1;
+static gint ett_switchinfo = -1;
+static gint ett_guidinfo = -1;
+static gint ett_portinfo = -1;
+static gint ett_portinfo_capmask = -1;
+static gint ett_pkeytable = -1;
+static gint ett_sltovlmapping = -1;
+static gint ett_vlarbitrationtable = -1;
+static gint ett_linearforwardingtable = -1;
+static gint ett_randomforwardingtable = -1;
+static gint ett_multicastforwardingtable = -1;
+static gint ett_sminfo = -1;
+static gint ett_vendordiag = -1;
+static gint ett_ledinfo = -1;
+static gint ett_linkspeedwidthpairs = -1;
+static gint ett_informinfo = -1;
+static gint ett_linkrecord = -1;
+static gint ett_servicerecord = -1;
+static gint ett_pathrecord = -1;
+static gint ett_mcmemberrecord = -1;
+static gint ett_tracerecord = -1;
+static gint ett_multipathrecord = -1;
+static gint ett_serviceassocrecord = -1;
+
+/* Global ref to highest level tree should we find other protocols encapsulated in IB */
+static proto_tree *top_tree = NULL;
+
+/* MAD_Data
+* Structure to hold information from the common MAD header.
+* This is necessary because the MAD header contains information which significantly changes the dissection algorithm. */
+typedef struct {
+ guint8 managementClass;
+ guint8 classVersion;
+ guint8 method;
+ guint8 status;
+ guint16 classSpecific;
+ guint64 transactionID;
+ guint16 attributeID;
+ guint32 attributeModifier;
+ char data[232];
+} MAD_Data;
+
+/* Dissector Declarations */
+static dissector_handle_t ipv6_handle;
+static dissector_handle_t data_handle;
+static dissector_table_t ethertype_dissector_table;
+
+static void dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree);
+static gint32 find_next_header_sequence(guint32 OpCode);
+static gboolean contains(guint32 value, guint32* arr, int length);
+static void dissect_general_info(tvbuff_t *tvb, gint offset, packet_info *pinfo);
+
+/* Parsing Methods for specific IB headers. */
+
+static void parse_VENDOR(proto_tree *, tvbuff_t *, gint *);
+static void parse_PAYLOAD(proto_tree *, packet_info *, tvbuff_t *, gint *, gint length, guint8 virtualLane);
+static void parse_IETH(proto_tree *, tvbuff_t *, gint *);
+static void parse_IMMDT(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_ATOMICACKETH(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_AETH(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_ATOMICETH(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_RETH(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_DETH(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_RDETH(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_IPvSix(proto_tree *, tvbuff_t *, gint *offset, packet_info *);
+static void parse_RWH(proto_tree *, tvbuff_t *, gint *offset, packet_info *);
+
+static void parse_SUBN_LID_ROUTED(proto_tree *, packet_info *, tvbuff_t *, gint *offset);
+static void parse_SUBN_DIRECTED_ROUTE(proto_tree *, packet_info *, tvbuff_t *, gint *offset);
+static void parse_SUBNADMN(proto_tree *, packet_info *, tvbuff_t *, gint *offset);
+static void parse_PERF(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_BM(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_DEV_MGT(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_COM_MGT(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_SNMP(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_VENDOR_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_APPLICATION_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset);
+static void parse_RESERVED_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset);
+
+static gboolean parse_MAD_Common(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
+static gboolean parse_RMPP(proto_tree* , tvbuff_t* , gint *offset);
+static void label_SUBM_Method(proto_item*, MAD_Data*, packet_info*);
+static void label_SUBM_Attribute(proto_item*, MAD_Data*, packet_info*);
+static void label_SUBA_Method(proto_item*, MAD_Data*, packet_info*);
+static void label_SUBA_Attribute(proto_item*, MAD_Data*, packet_info*);
+
+/* Class Attribute Parsing Routines */
+static gboolean parse_SUBM_Attribute(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
+static gboolean parse_SUBA_Attribute(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
+
+/* These methods parse individual attributes
+* Naming convention FunctionHandle = "parse_" + [Attribute Name];
+* Where [Attribute Name] is the attribute identifier from chapter 14 of the IB Specification
+* Subnet Management */
+static void parse_NoticesAndTraps(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_NodeDescription(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_NodeInfo(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_SwitchInfo(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_GUIDInfo(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_PortInfo(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_P_KeyTable(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_SLtoVLMappingTable(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_VLArbitrationTable(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_LinearForwardingTable(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_RandomForwardingTable(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_MulticastForwardingTable(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_SMInfo(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_VendorDiag(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_LedInfo(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_LinkSpeedWidthPairsTable(proto_tree*, tvbuff_t*, gint *offset);
+
+/* Subnet Administration */
+static void parse_InformInfo(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_LinkRecord(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_ServiceRecord(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_PathRecord(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_MCMemberRecord(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_TraceRecord(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_MultiPathRecord(proto_tree*, tvbuff_t*, gint *offset);
+static void parse_ServiceAssociationRecord(proto_tree*, tvbuff_t*, gint *offset);
+
+/* Subnet Administration */
+static void parse_RID(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
+
+/* SM Methods */
+static const value_string SUBM_Methods[] = {
+ { 0x01, "SubnGet("},
+ { 0x02, "SubnSet("},
+ { 0x81, "SubnGetResp("},
+ { 0x05, "SubnTrap("},
+ { 0x07, "SubnTrapResp("},
+ { 0, NULL}
+};
+/* SM Attributes */
+static const value_string SUBM_Attributes[] = {
+ { 0x0001, "Attribute (ClassPortInfo)"},
+ { 0x0002, "Attribute (Notice)"},
+ { 0x0003, "Attribute (InformInfo)"},
+ { 0x0010, "Attribute (NodeDescription)"},
+ { 0x0011, "Attribute (NodeInfo)"},
+ { 0x0012, "Attribute (SwitchInfo)"},
+ { 0x0014, "Attribute (GUIDInfo)"},
+ { 0x0015, "Attribute (PortInfo)"},
+ { 0x0016, "Attribute (P_KeyTable)"},
+ { 0x0017, "Attribute (SLtoVLMapptingTable)"},
+ { 0x0018, "Attribute (VLArbitrationTable)"},
+ { 0x0019, "Attribute (LinearForwardingTable)"},
+ { 0x001A, "Attribute (RandomForwardingTable)"},
+ { 0x001B, "Attribute (MulticastForwardingTable)"},
+ { 0x001C, "Attribute (LinkSpeedWidthPairsTable)"},
+ { 0x0020, "Attribute (SMInfo)"},
+ { 0x0030, "Attribute (VendorDiag)"},
+ { 0x0031, "Attribute (LedInfo)"},
+ { 0, NULL}
+};
+
+/* SA Methods */
+static const value_string SUBA_Methods[] = {
+ { 0x01, "SubnAdmGet("},
+ { 0x81, "SubnAdmGetResp("},
+ { 0x02, "SubnAdmSet("},
+ { 0x06, "SubnAdmReport("},
+ { 0x86, "SubnAdmReportResp("},
+ { 0x12, "SubnAdmGetTable("},
+ { 0x92, "SubnAdmGetTableResp("},
+ { 0x13, "SubnAdmGetTraceTable("},
+ { 0x14, "SubnAdmGetMulti("},
+ { 0x94, "SubnAdmGetMultiResp("},
+ { 0x15, "SubnAdmDelete("},
+ { 0x95, "SubnAdmDeleteResp("},
+ { 0, NULL}
+};
+/* SA Attributes */
+static const value_string SUBA_Attributes[] = {
+ { 0x0001, "Attribute (ClassPortInfo)"},
+ { 0x0002, "Attribute (Notice)"},
+ { 0x0003, "Attribute (InformInfo)"},
+ { 0x0011, "Attribute (NodeRecord)"},
+ { 0x0012, "Attribute (PortInfoRecord)"},
+ { 0x0013, "Attribute (SLtoVLMappingTableRecord)"},
+ { 0x0014, "Attribute (SwitchInfoRecord)"},
+ { 0x0015, "Attribute (LinearForwardingTableRecord)"},
+ { 0x0016, "Attribute (RandomForwardingTableRecord)"},
+ { 0x0017, "Attribute (MulticastForwardingTableRecord)"},
+ { 0x0018, "Attribute (SMInfoRecord)"},
+ { 0x0019, "Attribute (LinkSpeedWidthPairsTableRecord)"},
+ { 0x00F3, "Attribute (InformInfoRecord)"},
+ { 0x0020, "Attribute (LinkRecord)"},
+ { 0x0030, "Attribute (GuidInfoRecord)"},
+ { 0x0031, "Attribute (ServiceRecord)"},
+ { 0x0033, "Attribute (P_KeyTableRecord)"},
+ { 0x0035, "Attribute (PathRecord)"},
+ { 0x0036, "Attribute (VLArbitrationTableRecord)"},
+ { 0x0038, "Attribute (MCMembersRecord)"},
+ { 0x0039, "Attribute (TraceRecord)"},
+ { 0x003A, "Attribute (MultiPathRecord)"},
+ { 0x003B, "Attribute (ServiceAssociationRecord)"},
+ { 0, NULL}
+};
+
+
+/* RMPP Types */
+#define RMPP_ILLEGAL 0
+#define RMPP_DATA 1
+#define RMPP_ACK 2
+#define RMPP_STOP 3
+#define RMPP_ABORT 4
+
+static const value_string RMPP_Packet_Types[] = {
+ { RMPP_ILLEGAL, " Illegal RMPP Type (0)! " },
+ { RMPP_DATA, "RMPP (DATA)" },
+ { RMPP_ACK, "RMPP (ACK)" },
+ { RMPP_STOP, "RMPP (STOP)" },
+ { RMPP_ABORT, "RMPP (ABORT)" },
+ { 0, NULL}
+};
+
+static const value_string RMPP_Flags[] = {
+ { 3, " (Transmission Sequence - First Packet)"},
+ { 5, " (Transmission Sequence - Last Packet)"},
+ { 1, " (Transmission Sequence) " },
+ { 0, NULL}
+};
+
+static const value_string RMPP_Status[]= {
+ { 0, " (Normal)"},
+ { 1, " (Resources Exhausted)"},
+ { 118, " (Total Time Too Long)"},
+ { 119, " (Inconsistent Last and PayloadLength)"},
+ { 120, " (Inconsistent First and Segment Number)"},
+ { 121, " (Bad RMPPType)"},
+ { 122, " (NewWindowLast Too Small)"},
+ { 123, " (SegmentNumber Too Big)"},
+ { 124, " (Illegal Status)"},
+ { 125, " (Unsupported Version)"},
+ { 126, " (Too Many Retries)"},
+ { 127, " (Unspecified - Unknown Error Code on ABORT)"},
+ { 0, NULL}
+};
+
+static const value_string DiagCode[]= {
+ {0x0000, "Function Ready"},
+ {0x0001, "Performing Self Test"},
+ {0x0002, "Initializing"},
+ {0x0003, "Soft Error - Function has non-fatal error"},
+ {0x0004, "Hard Error - Function has fatal error"},
+ { 0, NULL}
+};
+static const value_string LinkWidthEnabled[]= {
+ {0x0000, "No State Change"},
+ {0x0001, "1x"},
+ {0x0002, "4x"},
+ {0x0003, "1x or 4x"},
+ {0x0004, "8x"},
+ {0x0005, "1x or 8x"},
+ {0x0006, "4x or 8x"},
+ {0x0007, "1x or 4x or 8x"},
+ {0x0008, "12x"},
+ {0x0009, "1x or 12x"},
+ {0x000A, "4x or 12x"},
+ {0x000B, "1x or 4x or 12x"},
+ {0x000C, "8x or 12x"},
+ {0x000D, "1x or 8x or 12x"},
+ {0x000E, "4x or 8x or 12x"},
+ {0x000E, "1x or 4x or 8x or 12x"},
+ {0x00FF, "Set to LinkWidthSupported Value - Response contains actual LinkWidthSupported"},
+ { 0, NULL}
+};
+
+static const value_string LinkWidthSupported[]= {
+ {0x0001, "1x"},
+ {0x0003, "1x or 4x"},
+ {0x0007, "1x or 4x or 8x"},
+ {0x000B, "1x or 4x or 12x"},
+ {0x000F, "1x or 4x or 8x or 12x"},
+ { 0, NULL}
+};
+static const value_string LinkWidthActive[]= {
+ {0x0001, "1x"},
+ {0x0002, "4x"},
+ {0x0004, "8x"},
+ {0x0008, "12x"},
+ { 0, NULL}
+};
+static const value_string LinkSpeedSupported[]= {
+ {0x0001, "2.5 Gbps"},
+ {0x0003, "2.5 or 5.0 Gbps"},
+ {0x0005, "2.5 or 10.0 Gbps"},
+ {0x0007, "2.5 or 5.0 or 10.0 Gbps"},
+ { 0, NULL}
+};
+static const value_string PortState[]= {
+ {0x0000, "No State Change"},
+ {0x0001, "Down (includes failed links)"},
+ {0x0002, "Initialized"},
+ {0x0003, "Armed"},
+ {0x0004, "Active"},
+ { 0, NULL}
+};
+static const value_string PortPhysicalState[]= {
+ {0x0000, "No State Change"},
+ {0x0001, "Sleep"},
+ {0x0002, "Polling"},
+ {0x0003, "Disabled"},
+ {0x0004, "PortConfigurationTraining"},
+ {0x0005, "LinkUp"},
+ {0x0006, "LinkErrorRecovery"},
+ {0x0007, "Phy Test"},
+ { 0, NULL}
+};
+static const value_string LinkDownDefaultState[]= {
+ {0x0000, "No State Change"},
+ {0x0001, "Sleep"},
+ {0x0002, "Polling"},
+ { 0, NULL}
+};
+static const value_string LinkSpeedActive[]= {
+ {0x0001, "2.5 Gbps"},
+ {0x0002, "5.0 Gbps"},
+ {0x0004, "10.0 Gbps"},
+ { 0, NULL}
+};
+static const value_string LinkSpeedEnabled[]= {
+ {0x0000, "No State Change"},
+ {0x0001, "2.5 Gbps"},
+ {0x0003, "2.5 or 5.0 Gbps"},
+ {0x0005, "2.5 or 10.0 Gbps"},
+ {0x0007, "2.5 or 5.0 or 10.0 Gbps"},
+ {0x000F, "Set to LinkSpeedSupported value - response contains actual LinkSpeedSupported"},
+ { 0, NULL}
+};
+static const value_string NeighborMTU[]= {
+ {0x0001, "256"},
+ {0x0002, "512"},
+ {0x0003, "1024"},
+ {0x0004, "2048"},
+ {0x0005, "4096"},
+ { 0, NULL}
+};
+static const value_string VLCap[]= {
+ {0x0001, "VL0"},
+ {0x0002, "VL0, VL1"},
+ {0x0003, "VL0 - VL3"},
+ {0x0004, "VL0 - VL7"},
+ {0x0005, "VL0 - VL14"},
+ { 0, NULL}
+};
+static const value_string MTUCap[]= {
+ {0x0001, "256"},
+ {0x0002, "512"},
+ {0x0003, "1024"},
+ {0x0004, "2048"},
+ {0x0005, "4096"},
+ { 0, NULL}
+};
+static const value_string OperationalVLs[]= {
+ {0x0000, "No State Change"},
+ {0x0001, "VL0"},
+ {0x0002, "VL0, VL1"},
+ {0x0003, "VL0 - VL3"},
+ {0x0004, "VL0 - VL7"},
+ {0x0005, "VL0 - VL14"},
+ { 0, NULL}
+};
+
+/* Local Route Header (LRH) */
+static int hf_infiniband_LRH = -1;
+static int hf_infiniband_virtual_lane = -1;
+static int hf_infiniband_link_version = -1;
+static int hf_infiniband_service_level = -1;
+static int hf_infiniband_reserved2 = -1;
+static int hf_infiniband_link_next_header = -1;
+static int hf_infiniband_destination_local_id = -1;
+static int hf_infiniband_reserved5 = -1;
+static int hf_infiniband_packet_length = -1;
+static int hf_infiniband_source_local_id = -1;
+/* Global Route Header (GRH) */
+static int hf_infiniband_GRH = -1;
+static int hf_infiniband_ip_version = -1;
+static int hf_infiniband_traffic_class = -1;
+static int hf_infiniband_flow_label = -1;
+static int hf_infiniband_payload_length = -1;
+static int hf_infiniband_next_header = -1;
+static int hf_infiniband_hop_limit = -1;
+static int hf_infiniband_source_gid = -1;
+static int hf_infiniband_destination_gid = -1;
+/* Base Transport Header (BTH) */
+static int hf_infiniband_BTH = -1;
+static int hf_infiniband_opcode = -1;
+static int hf_infiniband_solicited_event = -1;
+static int hf_infiniband_migreq = -1;
+static int hf_infiniband_pad_count = -1;
+static int hf_infiniband_transport_header_version = -1;
+static int hf_infiniband_partition_key = -1;
+static int hf_infiniband_reserved8 = -1;
+static int hf_infiniband_destination_qp = -1;
+static int hf_infiniband_acknowledge_request = -1;
+static int hf_infiniband_reserved7 = -1;
+static int hf_infiniband_packet_sequence_number = -1;
+/* Raw Header (RWH) */
+static int hf_infiniband_RWH = -1;
+static int hf_infiniband_reserved16_RWH = -1;
+static int hf_infiniband_etype = -1;
+/* Reliable Datagram Extended Transport Header (RDETH) */
+static int hf_infiniband_RDETH = -1;
+static int hf_infiniband_reserved8_RDETH = -1;
+static int hf_infiniband_ee_context = -1;
+/* Datagram Extended Transport Header (DETH) */
+static int hf_infiniband_DETH = -1;
+static int hf_infiniband_queue_key = -1;
+static int hf_infiniband_reserved8_DETH = -1;
+static int hf_infiniband_source_qp = -1;
+/* RDMA Extended Transport Header (RETH) */
+static int hf_infiniband_RETH = -1;
+static int hf_infiniband_virtual_address = -1;
+static int hf_infiniband_remote_key = -1;
+static int hf_infiniband_dma_length = -1;
+/* Atomic Extended Transport Header (AtomicETH) */
+static int hf_infiniband_AtomicETH = -1;
+static int hf_infiniband_virtual_address_AtomicETH = -1;
+static int hf_infiniband_remote_key_AtomicETH = -1;
+static int hf_infiniband_swap_or_add_data = -1;
+static int hf_infiniband_compare_data = -1;
+/* ACK Extended Transport Header (AETH) */
+static int hf_infiniband_AETH = -1;
+static int hf_infiniband_syndrome = -1;
+static int hf_infiniband_message_sequence_number = -1;
+/* Atomic ACK Extended Transport Header (AtomicAckETH) */
+static int hf_infiniband_AtomicAckETH = -1;
+static int hf_infiniband_original_remote_data = -1;
+/* Immediate Extended Transport Header (ImmDt) */
+static int hf_infiniband_IMMDT = -1;
+/* Invalidate Extended Transport Header (IETH) */
+static int hf_infiniband_IETH = -1;
+/* Payload */
+static int hf_infiniband_payload = -1;
+static int hf_infiniband_invariant_crc = -1;
+static int hf_infiniband_variant_crc = -1;
+/* Unknown or Vendor Specific */
+static int hf_infiniband_raw_data = -1;
+static int hf_infiniband_vendor = -1;
+/* MAD Base Header */
+static int hf_infiniband_MAD = -1;
+static int hf_infiniband_base_version = -1;
+static int hf_infiniband_mgmt_class = -1;
+static int hf_infiniband_class_version = -1;
+static int hf_infiniband_reserved1 = -1;
+static int hf_infiniband_method = -1;
+static int hf_infiniband_status = -1;
+static int hf_infiniband_class_specific = -1;
+static int hf_infiniband_transaction_id = -1;
+static int hf_infiniband_attribute_id = -1;
+static int hf_infiniband_reserved16 = -1;
+static int hf_infiniband_attribute_modifier = -1;
+static int hf_infiniband_data = -1;
+/* RMPP Header */
+static int hf_infiniband_RMPP = -1;
+static int hf_infiniband_rmpp_version = -1;
+static int hf_infiniband_rmpp_type = -1;
+static int hf_infiniband_r_resp_time = -1;
+static int hf_infiniband_rmpp_flags = -1;
+static int hf_infiniband_rmpp_status = -1;
+static int hf_infiniband_rmpp_data1 = -1;
+static int hf_infiniband_rmpp_data2 = -1;
+/* RMPP Data */
+static int hf_infiniband_RMPP_DATA = -1;
+static int hf_infiniband_segment_number = -1;
+static int hf_infiniband_payload_length32 = -1;
+static int hf_infiniband_transferred_data = -1;
+/* RMPP ACK */
+static int hf_infiniband_new_window_last = -1;
+static int hf_infiniband_reserved220 = -1;
+/* RMPP ABORT and STOP */
+static int hf_infiniband_reserved32 = -1;
+static int hf_infiniband_optional_extended_error_data = -1;
+/* SMP Data LID Routed */
+static int hf_infiniband_SMP_LID = -1;
+static int hf_infiniband_m_key = -1;
+static int hf_infiniband_smp_data = -1;
+static int hf_infiniband_reserved1024 = -1;
+static int hf_infiniband_reserved256 = -1;
+/* SMP Data Directed Route */
+static int hf_infiniband_SMP_DIRECTED = -1;
+static int hf_infiniband_smp_status = -1;
+static int hf_infiniband_hop_pointer = -1;
+static int hf_infiniband_hop_count = -1;
+static int hf_infiniband_dr_slid = -1;
+static int hf_infiniband_dr_dlid = -1;
+static int hf_infiniband_reserved28 = -1;
+static int hf_infiniband_d = -1;
+static int hf_infiniband_initial_path = -1;
+static int hf_infiniband_return_path = -1;
+/* SA MAD Header */
+static int hf_infiniband_SA = -1;
+static int hf_infiniband_sm_key = -1;
+static int hf_infiniband_attribute_offset = -1;
+static int hf_infiniband_component_mask = -1;
+static int hf_infiniband_subnet_admin_data = -1;
+
+/* Attributes
+* Additional Structures for individuala attribute decoding.
+* Since they are not headers the naming convention is slightly modified
+* Convention: hf_infiniband_[attribute name]_[field]
+* This was not entirely necessary but I felt the previous convention
+* did not provide adequate readability for the granularity of attribute/attribute fields. */
+
+/* NodeDescription */
+static int hf_infiniband_NodeDescription_NodeString = -1;
+/* NodeInfo */
+static int hf_infiniband_NodeInfo_BaseVersion = -1;
+static int hf_infiniband_NodeInfo_ClassVersion = -1;
+static int hf_infiniband_NodeInfo_NodeType = -1;
+static int hf_infiniband_NodeInfo_NumPorts = -1;
+static int hf_infiniband_NodeInfo_SystemImageGUID = -1;
+static int hf_infiniband_NodeInfo_NodeGUID = -1;
+static int hf_infiniband_NodeInfo_PortGUID = -1;
+static int hf_infiniband_NodeInfo_PartitionCap = -1;
+static int hf_infiniband_NodeInfo_DeviceID = -1;
+static int hf_infiniband_NodeInfo_Revision = -1;
+static int hf_infiniband_NodeInfo_LocalPortNum = -1;
+static int hf_infiniband_NodeInfo_VendorID = -1;
+/* SwitchInfo */
+static int hf_infiniband_SwitchInfo_LinearFDBCap = -1;
+static int hf_infiniband_SwitchInfo_RandomFDBCap = -1;
+static int hf_infiniband_SwitchInfo_MulticastFDBCap = -1;
+static int hf_infiniband_SwitchInfo_LinearFDBTop = -1;
+static int hf_infiniband_SwitchInfo_DefaultPort = -1;
+static int hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort = -1;
+static int hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort = -1;
+static int hf_infiniband_SwitchInfo_LifeTimeValue = -1;
+static int hf_infiniband_SwitchInfo_PortStateChange = -1;
+static int hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming = -1;
+static int hf_infiniband_SwitchInfo_LIDsPerPort = -1;
+static int hf_infiniband_SwitchInfo_PartitionEnforcementCap = -1;
+static int hf_infiniband_SwitchInfo_InboundEnforcementCap = -1;
+static int hf_infiniband_SwitchInfo_OutboundEnforcementCap = -1;
+static int hf_infiniband_SwitchInfo_FilterRawInboundCap = -1;
+static int hf_infiniband_SwitchInfo_FilterRawOutboundCap = -1;
+static int hf_infiniband_SwitchInfo_EnhancedPortZero = -1;
+/* GUIDInfo */
+static int hf_infiniband_GUIDInfo_GUIDBlock = -1;
+static int hf_infiniband_GUIDInfo_GUID = -1;
+/* PortInfo */
+static int hf_infiniband_PortInfo_GidPrefix = -1;
+static int hf_infiniband_PortInfo_LID = -1;
+static int hf_infiniband_PortInfo_MasterSMLID = -1;
+static int hf_infiniband_PortInfo_CapabilityMask = -1;
+
+/* Capability Mask Flags */
+static int hf_infiniband_PortInfo_CapabilityMask_SM;
+static int hf_infiniband_PortInfo_CapabilityMask_NoticeSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_TrapSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_SMdisabled = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_ReinitSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported = -1;
+static int hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported = -1;
+/* End Capability Mask Flags */
+
+
+static int hf_infiniband_PortInfo_DiagCode = -1;
+static int hf_infiniband_PortInfo_M_KeyLeasePeriod = -1;
+static int hf_infiniband_PortInfo_LocalPortNum = -1;
+static int hf_infiniband_PortInfo_LinkWidthEnabled = -1;
+static int hf_infiniband_PortInfo_LinkWidthSupported = -1;
+static int hf_infiniband_PortInfo_LinkWidthActive = -1;
+static int hf_infiniband_PortInfo_LinkSpeedSupported = -1;
+static int hf_infiniband_PortInfo_PortState = -1;
+static int hf_infiniband_PortInfo_PortPhysicalState = -1;
+static int hf_infiniband_PortInfo_LinkDownDefaultState = -1;
+static int hf_infiniband_PortInfo_M_KeyProtectBits = -1;
+static int hf_infiniband_PortInfo_LMC = -1;
+static int hf_infiniband_PortInfo_LinkSpeedActive = -1;
+static int hf_infiniband_PortInfo_LinkSpeedEnabled = -1;
+static int hf_infiniband_PortInfo_NeighborMTU = -1;
+static int hf_infiniband_PortInfo_MasterSMSL = -1;
+static int hf_infiniband_PortInfo_VLCap = -1;
+static int hf_infiniband_PortInfo_M_Key = -1;
+static int hf_infiniband_PortInfo_InitType = -1;
+static int hf_infiniband_PortInfo_VLHighLimit = -1;
+static int hf_infiniband_PortInfo_VLArbitrationHighCap = -1;
+static int hf_infiniband_PortInfo_VLArbitrationLowCap = -1;
+static int hf_infiniband_PortInfo_InitTypeReply = -1;
+static int hf_infiniband_PortInfo_MTUCap = -1;
+static int hf_infiniband_PortInfo_VLStallCount = -1;
+static int hf_infiniband_PortInfo_HOQLife = -1;
+static int hf_infiniband_PortInfo_OperationalVLs = -1;
+static int hf_infiniband_PortInfo_PartitionEnforcementInbound = -1;
+static int hf_infiniband_PortInfo_PartitionEnforcementOutbound = -1;
+static int hf_infiniband_PortInfo_FilterRawInbound = -1;
+static int hf_infiniband_PortInfo_FilterRawOutbound = -1;
+static int hf_infiniband_PortInfo_M_KeyViolations = -1;
+static int hf_infiniband_PortInfo_P_KeyViolations = -1;
+static int hf_infiniband_PortInfo_Q_KeyViolations = -1;
+static int hf_infiniband_PortInfo_GUIDCap = -1;
+static int hf_infiniband_PortInfo_ClientReregister = -1;
+static int hf_infiniband_PortInfo_SubnetTimeOut = -1;
+static int hf_infiniband_PortInfo_RespTimeValue = -1;
+static int hf_infiniband_PortInfo_LocalPhyErrors = -1;
+static int hf_infiniband_PortInfo_OverrunErrors = -1;
+static int hf_infiniband_PortInfo_MaxCreditHint = -1;
+static int hf_infiniband_PortInfo_LinkRoundTripLatency = -1;
+
+/* P_KeyTable */
+static int hf_infiniband_P_KeyTable_P_KeyTableBlock = -1;
+static int hf_infiniband_P_KeyTable_MembershipType = -1;
+static int hf_infiniband_P_KeyTable_P_KeyBase = -1;
+
+/* SLtoVLMappingTable */
+static int hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits = -1;
+static int hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits = -1;
+
+/* VLArbitrationTable */
+static int hf_infiniband_VLArbitrationTable_VLWeightPairs = -1;
+static int hf_infiniband_VLArbitrationTable_VL = -1;
+static int hf_infiniband_VLArbitrationTable_Weight = -1;
+
+/* LinearForwardingTable */
+static int hf_infiniband_LinearForwardingTable_LinearForwardingTableBlock = -1;
+static int hf_infiniband_LinearForwardingTable_Port = -1;
+
+/* RandomForwardingTable */
+static int hf_infiniband_RandomForwardingTable_RandomForwardingTableBlock = -1;
+static int hf_infiniband_RandomForwardingTable_LID = -1;
+static int hf_infiniband_RandomForwardingTable_Valid = -1;
+static int hf_infiniband_RandomForwardingTable_LMC = -1;
+static int hf_infiniband_RandomForwardingTable_Port = -1;
+
+/* MulticastForwardingTable */
+static int hf_infiniband_MulticastForwardingTable_MulticastForwardingTableBlock = -1;
+static int hf_infiniband_MulticastForwardingTable_PortMask = -1;
+
+/* SMInfo */
+static int hf_infiniband_SMInfo_GUID = -1;
+static int hf_infiniband_SMInfo_SM_Key = -1;
+static int hf_infiniband_SMInfo_ActCount = -1;
+static int hf_infiniband_SMInfo_Priority = -1;
+static int hf_infiniband_SMInfo_SMState = -1;
+
+/* VendorDiag */
+static int hf_infiniband_VendorDiag_NextIndex = -1;
+static int hf_infiniband_VendorDiag_DiagData = -1;
+
+/* LedInfo */
+static int hf_infiniband_LedInfo_LedMask = -1;
+
+/* LinkSpeedWidthPairsTable */
+static int hf_infiniband_LinkSpeedWidthPairsTable_NumTables = -1;
+static int hf_infiniband_LinkSpeedWidthPairsTable_PortMask = -1;
+static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive = -1;
+static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive = -1;
+static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen = -1;
+
+/* Attributes for Subnet Administration.
+* Mostly we have "Records" here which are just structures of SM attributes.
+* There are some unique attributes though that we will want to have a structure for. */
+
+/* NodeRecord */
+/* PortInfoRecord */
+/* SLtoVLMappingTableRecord */
+/* SwitchInfoRecord */
+/* LinearForwardingTableRecord */
+/* RandomForwardingTableRecord */
+/* MulticastForwardingTableRecord */
+/* VLArbitrationTableRecord */
+
+static int hf_infiniband_SA_LID = -1;
+static int hf_infiniband_SA_EndportLID = -1;
+static int hf_infiniband_SA_PortNum = -1;
+static int hf_infiniband_SA_InputPortNum = -1;
+static int hf_infiniband_SA_OutputPortNum = -1;
+static int hf_infiniband_SA_BlockNum_EightBit = -1;
+static int hf_infiniband_SA_BlockNum_NineBit = -1;
+static int hf_infiniband_SA_BlockNum_SixteenBit = -1;
+static int hf_infiniband_SA_Position = -1;
+static int hf_infiniband_SA_Index = -1;
+
+/* InformInfoRecord */
+static int hf_infiniband_InformInfoRecord_SubscriberGID = -1;
+static int hf_infiniband_InformInfoRecord_Enum = -1;
+
+/* InformInfo */
+static int hf_infiniband_InformInfo_GID = -1;
+static int hf_infiniband_InformInfo_LIDRangeBegin = -1;
+static int hf_infiniband_InformInfo_LIDRangeEnd = -1;
+static int hf_infiniband_InformInfo_IsGeneric = -1;
+static int hf_infiniband_InformInfo_Subscribe = -1;
+static int hf_infiniband_InformInfo_Type = -1;
+static int hf_infiniband_InformInfo_TrapNumberDeviceID = -1;
+static int hf_infiniband_InformInfo_QPN = -1;
+static int hf_infiniband_InformInfo_RespTimeValue = -1;
+static int hf_infiniband_InformInfo_ProducerTypeVendorID = -1;
+
+/* LinkRecord */
+static int hf_infiniband_LinkRecord_FromLID = -1;
+static int hf_infiniband_LinkRecord_FromPort = -1;
+static int hf_infiniband_LinkRecord_ToPort = -1;
+static int hf_infiniband_LinkRecord_ToLID = -1;
+
+/* ServiceRecord */
+static int hf_infiniband_ServiceRecord_ServiceID = -1;
+static int hf_infiniband_ServiceRecord_ServiceGID = -1;
+static int hf_infiniband_ServiceRecord_ServiceP_Key = -1;
+static int hf_infiniband_ServiceRecord_ServiceLease = -1;
+static int hf_infiniband_ServiceRecord_ServiceKey = -1;
+static int hf_infiniband_ServiceRecord_ServiceName = -1;
+static int hf_infiniband_ServiceRecord_ServiceData = -1;
+
+/* ServiceAssociationRecord */
+static int hf_infiniband_ServiceAssociationRecord_ServiceKey = -1;
+static int hf_infiniband_ServiceAssociationRecord_ServiceName = -1;
+
+/* PathRecord */
+static int hf_infiniband_PathRecord_DGID = -1;
+static int hf_infiniband_PathRecord_SGID = -1;
+static int hf_infiniband_PathRecord_DLID = -1;
+static int hf_infiniband_PathRecord_SLID = -1;
+static int hf_infiniband_PathRecord_RawTraffic = -1;
+static int hf_infiniband_PathRecord_FlowLabel = -1;
+static int hf_infiniband_PathRecord_HopLimit = -1;
+static int hf_infiniband_PathRecord_TClass = -1;
+static int hf_infiniband_PathRecord_Reversible = -1;
+static int hf_infiniband_PathRecord_NumbPath = -1;
+static int hf_infiniband_PathRecord_P_Key = -1;
+static int hf_infiniband_PathRecord_SL = -1;
+static int hf_infiniband_PathRecord_MTUSelector = -1;
+static int hf_infiniband_PathRecord_MTU = -1;
+static int hf_infiniband_PathRecord_RateSelector = -1;
+static int hf_infiniband_PathRecord_Rate = -1;
+static int hf_infiniband_PathRecord_PacketLifeTimeSelector = -1;
+static int hf_infiniband_PathRecord_PacketLifeTime = -1;
+static int hf_infiniband_PathRecord_Preference = -1;
+
+/* MCMemberRecord */
+static int hf_infiniband_MCMemberRecord_MGID = -1;
+static int hf_infiniband_MCMemberRecord_PortGID = -1;
+static int hf_infiniband_MCMemberRecord_Q_Key = -1;
+static int hf_infiniband_MCMemberRecord_MLID = -1;
+static int hf_infiniband_MCMemberRecord_MTUSelector = -1;
+static int hf_infiniband_MCMemberRecord_MTU = -1;
+static int hf_infiniband_MCMemberRecord_TClass = -1;
+static int hf_infiniband_MCMemberRecord_P_Key = -1;
+static int hf_infiniband_MCMemberRecord_RateSelector = -1;
+static int hf_infiniband_MCMemberRecord_Rate = -1;
+static int hf_infiniband_MCMemberRecord_PacketLifeTimeSelector = -1;
+static int hf_infiniband_MCMemberRecord_PacketLifeTime = -1;
+static int hf_infiniband_MCMemberRecord_SL = -1;
+static int hf_infiniband_MCMemberRecord_FlowLabel = -1;
+static int hf_infiniband_MCMemberRecord_HopLimit = -1;
+static int hf_infiniband_MCMemberRecord_Scope = -1;
+static int hf_infiniband_MCMemberRecord_JoinState = -1;
+static int hf_infiniband_MCMemberRecord_ProxyJoin = -1;
+
+/* TraceRecord */
+static int hf_infiniband_TraceRecord_GIDPrefix = -1;
+static int hf_infiniband_TraceRecord_IDGeneration = -1;
+static int hf_infiniband_TraceRecord_NodeType = -1;
+static int hf_infiniband_TraceRecord_NodeID = -1;
+static int hf_infiniband_TraceRecord_ChassisID = -1;
+static int hf_infiniband_TraceRecord_EntryPortID = -1;
+static int hf_infiniband_TraceRecord_ExitPortID = -1;
+static int hf_infiniband_TraceRecord_EntryPort = -1;
+static int hf_infiniband_TraceRecord_ExitPort = -1;
+
+/* MultiPathRecord */
+static int hf_infiniband_MultiPathRecord_RawTraffic = -1;
+static int hf_infiniband_MultiPathRecord_FlowLabel = -1;
+static int hf_infiniband_MultiPathRecord_HopLimit = -1;
+static int hf_infiniband_MultiPathRecord_TClass = -1;
+static int hf_infiniband_MultiPathRecord_Reversible = -1;
+static int hf_infiniband_MultiPathRecord_NumbPath = -1;
+static int hf_infiniband_MultiPathRecord_P_Key = -1;
+static int hf_infiniband_MultiPathRecord_SL = -1;
+static int hf_infiniband_MultiPathRecord_MTUSelector = -1;
+static int hf_infiniband_MultiPathRecord_MTU = -1;
+static int hf_infiniband_MultiPathRecord_RateSelector = -1;
+static int hf_infiniband_MultiPathRecord_Rate = -1;
+static int hf_infiniband_MultiPathRecord_PacketLifeTimeSelector = -1;
+static int hf_infiniband_MultiPathRecord_PacketLifeTime = -1;
+static int hf_infiniband_MultiPathRecord_IndependenceSelector = -1;
+static int hf_infiniband_MultiPathRecord_GIDScope = -1;
+static int hf_infiniband_MultiPathRecord_SGIDCount = -1;
+static int hf_infiniband_MultiPathRecord_DGIDCount = -1;
+static int hf_infiniband_MultiPathRecord_SDGID = -1;
+
+/* Notice */
+static int hf_infiniband_Notice_IsGeneric = -1;
+static int hf_infiniband_Notice_Type = -1;
+static int hf_infiniband_Notice_ProducerTypeVendorID = -1;
+static int hf_infiniband_Notice_TrapNumberDeviceID = -1;
+static int hf_infiniband_Notice_IssuerLID = -1;
+static int hf_infiniband_Notice_NoticeToggle = -1;
+static int hf_infiniband_Notice_NoticeCount = -1;
+static int hf_infiniband_Notice_DataDetails = -1;
+static int hf_infiniband_Notice_IssuerGID = -1;
+static int hf_infiniband_Notice_ClassTrapSpecificData = -1;
+
+/* Notice DataDetails and ClassTrapSpecific Data for certain traps
+* Note that traps reuse many fields, so they are only declared once under the first trap that they appear.
+* There is no need to redeclare them for specific Traps (as with other SA Attributes) because they are uniform between Traps. */
+
+/* Parse DataDetails for a given Trap */
+static void parse_NoticeDataDetails(proto_tree*, tvbuff_t*, gint *offset, guint16 trapNumber);
+
+/* Traps 64,65,66,67 */
+static int hf_infiniband_Trap_GIDADDR = -1;
+
+/* Traps 68,69 */
+/* DataDetails */
+static int hf_infiniband_Trap_COMP_MASK = -1;
+static int hf_infiniband_Trap_WAIT_FOR_REPATH = -1;
+/* ClassTrapSpecificData */
+static int hf_infiniband_Trap_PATH_REC = -1;
+
+/* Trap 128 */
+static int hf_infiniband_Trap_LIDADDR = -1;
+
+/* Trap 129, 130, 131 */
+static int hf_infiniband_Trap_PORTNO = -1;
+
+/* Trap 144 */
+static int hf_infiniband_Trap_OtherLocalChanges = -1;
+static int hf_infiniband_Trap_CAPABILITYMASK = -1;
+static int hf_infiniband_Trap_LinkSpeecEnabledChange = -1;
+static int hf_infiniband_Trap_LinkWidthEnabledChange = -1;
+static int hf_infiniband_Trap_NodeDescriptionChange = -1;
+
+/* Trap 145 */
+static int hf_infiniband_Trap_SYSTEMIMAGEGUID = -1;
+
+/* Trap 256 */
+static int hf_infiniband_Trap_DRSLID = -1;
+static int hf_infiniband_Trap_METHOD = -1;
+static int hf_infiniband_Trap_ATTRIBUTEID = -1;
+static int hf_infiniband_Trap_ATTRIBUTEMODIFIER = -1;
+static int hf_infiniband_Trap_MKEY = -1;
+static int hf_infiniband_Trap_DRNotice = -1;
+static int hf_infiniband_Trap_DRPathTruncated = -1;
+static int hf_infiniband_Trap_DRHopCount = -1;
+static int hf_infiniband_Trap_DRNoticeReturnPath = -1;
+
+/* Trap 257, 258 */
+static int hf_infiniband_Trap_LIDADDR1 = -1;
+static int hf_infiniband_Trap_LIDADDR2 = -1;
+static int hf_infiniband_Trap_KEY = -1;
+static int hf_infiniband_Trap_SL = -1;
+static int hf_infiniband_Trap_QP1 = -1;
+static int hf_infiniband_Trap_QP2 = -1;
+static int hf_infiniband_Trap_GIDADDR1 = -1;
+static int hf_infiniband_Trap_GIDADDR2 = -1;
+
+/* Trap 259 */
+static int hf_infiniband_Trap_DataValid = -1;
+static int hf_infiniband_Trap_PKEY = -1;
+static int hf_infiniband_Trap_SWLIDADDR = -1;
+
+/* Trap Type/Descriptions for dissection */
+static const value_string Trap_Description[]= {
+ { 64, " (Informational) <GIDADDR> is now in service"},
+ { 65, " (Informational) <GIDADDR> is out of service"},
+ { 66, " (Informational) New Multicast Group with multicast address <GIDADDR> is now created"},
+ { 67, " (Informational) Multicast Group with multicast address <GIDADDR> is now deleted"},
+ { 68, " (Informational) Paths indicated by <PATH_REC> and <COMP_MASK> are no longer valid"},
+ { 69, " (Informational) Paths indicated by <PATH_REC> and <COMP_MASK> have been recomputed"},
+ { 128, " (Urgent) Link State of at least one port of switch at <LIDADDR> has changed"},
+ { 129, " (Urgent) Local Link Integrity threshold reached at <LIDADDR><PORTNO>"},
+ { 130, " (Urgent) Excessive Buffer OVerrun threshold reached at <LIDADDR><PORTNO>"},
+ { 131, " (Urgent) Flow Control Update watchdog timer expired at <LIDADDR><PORTNO>"},
+ { 144, " (Informational) CapMask, NodeDesc, LinkWidthEnabled or LinkSpeedEnabled at <LIDADDR> has been modified"},
+ { 145, " (Informational) SystemImageGUID at <LIDADDR> has been modified. New value is <SYSTEMIMAGEGUID>"},
+ { 256, " (Security) Bad M_Key, <M_KEY> from <LIDADDR> attempted <METHOD> with <ATTRIBUTEID> and <ATTRIBUTEMODIFIER>"},
+ { 257, " (Security) Bad P_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL>"},
+ { 258, " (Security) Bad Q_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL>"},
+ { 259, " (Security) Bad P_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL> at switch <LIDADDR><PORTNO>"},
+ { 0, NULL}
+};
+
+
+
+
+/* MAD Management Classes
+* Classes from the Common MAD Header
+*
+* Management Class Name Class Description
+* ------------------------------------------------------------------------------------------------------------ */
+#define SUBN_LID_ROUTED 0x01 /* Subnet Management LID Route */
+#define SUBN_DIRECTED_ROUTE 0x81 /* Subnet Management Directed Route */
+#define SUBNADMN 0x03 /* Subnet Administration */
+#define PERF 0x04 /* Performance Management */
+#define BM 0x05 /* Baseboard Management (Tunneling of IB-ML commands through the IBA subnet) */
+#define DEV_MGT 0x06 /* Device Management */
+#define COM_MGT 0x07 /* Communications Management */
+#define SNMP 0x08 /* SNMP Tunneling (tunneling of the SNMP protocol through the IBA fabric) */
+#define VENDOR_1_START 0x09 /* Start of first Vendor Specific Range */
+#define VENDOR_1_END 0x0F /* End of first Vendor Specific Range */
+#define VENDOR_2_START 0x30 /* Start of second Vendor Specific Range */
+#define VENDOR_2_END 0x4F /* End of the second Vendor Specific Range */
+#define APPLICATION_START 0x10 /* Start of Application Specific Range */
+#define APPLICATION_END 0x2F /* End of Application Specific Range */
+
+/* Link Next Header Values */
+#define IBA_GLOBAL 3
+#define IBA_LOCAL 2
+#define IP_NON_IBA 1
+#define RAW 0
+
+/* OpCodeValues
+* Code Bits [7-5] Connection Type
+* [4-0] Message Type
+
+* Reliable Connection (RC)
+* [7-5] = 000 */
+#define RC_SEND_FIRST 0 /*0x00000000 */
+#define RC_SEND_MIDDLE 1 /*0x00000001 */
+#define RC_SEND_LAST 2 /*0x00000010 */
+#define RC_SEND_LAST_IMM 3 /*0x00000011 */
+#define RC_SEND_ONLY 4 /*0x00000100 */
+#define RC_SEND_ONLY_IMM 5 /*0x00000101 */
+#define RC_RDMA_WRITE_FIRST 6 /*0x00000110 */
+#define RC_RDMA_WRITE_MIDDLE 7 /*0x00000111 */
+#define RC_RDMA_WRITE_LAST 8 /*0x00001000 */
+#define RC_RDMA_WRITE_LAST_IMM 9 /*0x00001001 */
+#define RC_RDMA_WRITE_ONLY 10 /*0x00001010 */
+#define RC_RDMA_WRITE_ONLY_IMM 11 /*0x00001011 */
+#define RC_RDMA_READ_REQUEST 12 /*0x00001100 */
+#define RC_RDMA_READ_RESPONSE_FIRST 13 /*0x00001101 */
+#define RC_RDMA_READ_RESPONSE_MIDDLE 14 /*0x00001110 */
+#define RC_RDMA_READ_RESPONSE_LAST 15 /*0x00001111 */
+#define RC_RDMA_READ_RESPONSE_ONLY 16 /*0x00010000 */
+#define RC_ACKNOWLEDGE 17 /*0x00010001 */
+#define RC_ATOMIC_ACKNOWLEDGE 18 /*0x00010010 */
+#define RC_CMP_SWAP 19 /*0x00010011 */
+#define RC_FETCH_ADD 20 /*0x00010100 */
+#define RC_SEND_LAST_INVAL 22 /*0x00010110 */
+#define RC_SEND_ONLY_INVAL 23 /*0x00010111 */
+
+/* Reliable Datagram (RD)
+* [7-5] = 010 */
+#define RD_SEND_FIRST 64 /*0x01000000 */
+#define RD_SEND_MIDDLE 65 /*0x01000001 */
+#define RD_SEND_LAST 66 /*0x01000010 */
+#define RD_SEND_LAST_IMM 67 /*0x01000011 */
+#define RD_SEND_ONLY 68 /*0x01000100 */
+#define RD_SEND_ONLY_IMM 69 /*0x01000101 */
+#define RD_RDMA_WRITE_FIRST 70 /*0x01000110 */
+#define RD_RDMA_WRITE_MIDDLE 71 /*0x01000111 */
+#define RD_RDMA_WRITE_LAST 72 /*0x01001000 */
+#define RD_RDMA_WRITE_LAST_IMM 73 /*0x01001001 */
+#define RD_RDMA_WRITE_ONLY 74 /*0x01001010 */
+#define RD_RDMA_WRITE_ONLY_IMM 75 /*0x01001011 */
+#define RD_RDMA_READ_REQUEST 76 /*0x01001100 */
+#define RD_RDMA_READ_RESPONSE_FIRST 77 /*0x01001101 */
+#define RD_RDMA_READ_RESPONSE_MIDDLE 78 /*0x01001110 */
+#define RD_RDMA_READ_RESPONSE_LAST 79 /*0x01001111 */
+#define RD_RDMA_READ_RESPONSE_ONLY 80 /*0x01010000 */
+#define RD_ACKNOWLEDGE 81 /*0x01010001 */
+#define RD_ATOMIC_ACKNOWLEDGE 82 /*0x01010010 */
+#define RD_CMP_SWAP 83 /*0x01010011 */
+#define RD_FETCH_ADD 84 /*0x01010100 */
+#define RD_RESYNC 85 /*0x01010101 */
+
+/* Unreliable Datagram (UD)
+* [7-5] = 011 */
+#define UD_SEND_ONLY 100 /*0x01100100 */
+#define UD_SEND_ONLY_IMM 101 /*0x01100101 */
+
+/* Unreliable Connection (UC)
+* [7-5] = 001 */
+#define UC_SEND_FIRST 32 /*0x00100000 */
+#define UC_SEND_MIDDLE 33 /*0x00100001 */
+#define UC_SEND_LAST 34 /*0x00100010 */
+#define UC_SEND_LAST_IMM 35 /*0x00100011 */
+#define UC_SEND_ONLY 36 /*0x00100100 */
+#define UC_SEND_ONLY_IMM 37 /*0x00100101 */
+#define UC_RDMA_WRITE_FIRST 38 /*0x00100110 */
+#define UC_RDMA_WRITE_MIDDLE 39 /*0x00100111 */
+#define UC_RDMA_WRITE_LAST 40 /*0x00101000 */
+#define UC_RDMA_WRITE_LAST_IMM 41 /*0x00101001 */
+#define UC_RDMA_WRITE_ONLY 42 /*0x00101010 */
+#define UC_RDMA_WRITE_ONLY_IMM 43 /*0x00101011 */
+
+static value_string OpCodeMap[] =
+{
+ { RC_SEND_FIRST, "RC Send First " },
+ { RC_SEND_MIDDLE, "RC Send Middle "},
+ { RC_SEND_LAST, "RC Send Last " },
+ { RC_SEND_LAST_IMM, "RC Send Last Immediate "},
+ { RC_SEND_ONLY, "RC Send Only "},
+ { RC_SEND_ONLY_IMM, "RC Send Only Immediate "},
+ { RC_RDMA_WRITE_FIRST, "RC RDMA Write First " },
+ { RC_RDMA_WRITE_MIDDLE, "RC RDMA Write Middle "},
+ { RC_RDMA_WRITE_LAST, "RC RDMA Write Last "},
+ { RC_RDMA_WRITE_LAST_IMM, "RC RDMA Write Last Immediate " },
+ { RC_RDMA_WRITE_ONLY, "RC RDMA Write Only " },
+ { RC_RDMA_WRITE_ONLY_IMM, "RC RDMA Write Only Immediate "},
+ { RC_RDMA_READ_REQUEST, "RC RDMA Read Request " },
+ { RC_RDMA_READ_RESPONSE_FIRST, "RC RDMA Read Response First " },
+ { RC_RDMA_READ_RESPONSE_MIDDLE, "RC RDMA Read Response Middle "},
+ { RC_RDMA_READ_RESPONSE_LAST, "RC RDMA Read Response Last " },
+ { RC_RDMA_READ_RESPONSE_ONLY, "RC RDMA Read Response Only "},
+ { RC_ACKNOWLEDGE, "RC Acknowledge " },
+ { RC_ATOMIC_ACKNOWLEDGE, "RC Atomic Acknowledge " },
+ { RC_CMP_SWAP, "RC Compare Swap " },
+ { RC_FETCH_ADD, "RC Fetch Add "},
+ { RC_SEND_LAST_INVAL, "RC Send Last Invalidate "},
+ { RC_SEND_ONLY_INVAL, "RC Send Only Invalidate " },
+
+
+ { RD_SEND_FIRST, "RD Send First "},
+ { RD_SEND_MIDDLE,"RD Send Middle " },
+ { RD_SEND_LAST, "RD Send Last "},
+ { RD_SEND_LAST_IMM, "RD Last Immediate " },
+ { RD_SEND_ONLY,"RD Send Only "},
+ { RD_SEND_ONLY_IMM,"RD Send Only Immediate "},
+ { RD_RDMA_WRITE_FIRST,"RD RDMA Write First "},
+ { RD_RDMA_WRITE_MIDDLE, "RD RDMA Write Middle "},
+ { RD_RDMA_WRITE_LAST,"RD RDMA Write Last "},
+ { RD_RDMA_WRITE_LAST_IMM,"RD RDMA Write Last Immediate "},
+ { RD_RDMA_WRITE_ONLY,"RD RDMA Write Only "},
+ { RD_RDMA_WRITE_ONLY_IMM,"RD RDMA Write Only Immediate "},
+ { RD_RDMA_READ_REQUEST,"RD RDMA Read Request "},
+ { RD_RDMA_READ_RESPONSE_FIRST,"RD RDMA Read Response First "},
+ { RD_RDMA_READ_RESPONSE_MIDDLE,"RD RDMA Read Response Middle "},
+ { RD_RDMA_READ_RESPONSE_LAST,"RD RDMA Read Response Last "},
+ { RD_RDMA_READ_RESPONSE_ONLY,"RD RDMA Read Response Only "},
+ { RD_ACKNOWLEDGE,"RD Acknowledge "},
+ { RD_ATOMIC_ACKNOWLEDGE,"RD Atomic Acknowledge "},
+ { RD_CMP_SWAP,"RD Compare Swap "},
+ { RD_FETCH_ADD, "RD Fetch Add "},
+ { RD_RESYNC,"RD RESYNC "},
+
+
+ { UD_SEND_ONLY, "UD Send Only "},
+ { UD_SEND_ONLY_IMM, "UD Send Only Immediate "},
+
+
+ { UC_SEND_FIRST,"UC Send First "},
+ { UC_SEND_MIDDLE,"UC Send Middle "},
+ { UC_SEND_LAST,"UC Send Last "},
+ { UC_SEND_LAST_IMM,"UC Send Last Immediate "},
+ { UC_SEND_ONLY,"UC Send Only "},
+ { UC_SEND_ONLY_IMM,"UC Send Only Immediate "},
+ { UC_RDMA_WRITE_FIRST,"UC RDMA Write First"},
+ { UC_RDMA_WRITE_MIDDLE,"Unreliable Connection RDMA Write Middle "},
+ { UC_RDMA_WRITE_LAST,"UC RDMA Write Last "},
+ { UC_RDMA_WRITE_LAST_IMM,"UC RDMA Write Last Immediate "},
+ { UC_RDMA_WRITE_ONLY,"UC RDMA Write Only "},
+ { UC_RDMA_WRITE_ONLY_IMM,"UC RDMA Write Only Immediate "},
+ { 0, NULL}
+
+};
+
+
+
+/* Header Ordering Based on OPCODES
+* These are simply an enumeration of the possible header combinations defined by the IB Spec.
+* These enumerations
+* #DEFINE [HEADER_ORDER] [ENUM]
+* __________________________________ */
+#define RDETH_DETH_PAYLD 0
+/* __________________________________ */
+#define RDETH_DETH_RETH_PAYLD 1
+/* __________________________________ */
+#define RDETH_DETH_IMMDT_PAYLD 2
+/* __________________________________ */
+#define RDETH_DETH_RETH_IMMDT_PAYLD 3
+/* __________________________________ */
+#define RDETH_DETH_RETH 4
+/* __________________________________ */
+#define RDETH_AETH_PAYLD 5
+/* __________________________________ */
+#define RDETH_PAYLD 6
+/* __________________________________ */
+#define RDETH_AETH 7
+/* __________________________________ */
+#define RDETH_AETH_ATOMICACKETH 8
+/* __________________________________ */
+#define RDETH_DETH_ATOMICETH 9
+/* ___________________________________ */
+#define RDETH_DETH 10
+/* ___________________________________ */
+#define DETH_PAYLD 11
+/* ___________________________________ */
+#define DETH_IMMDT_PAYLD 12
+/* ___________________________________ */
+#define PAYLD 13
+/* ___________________________________ */
+#define IMMDT_PAYLD 14
+/* ___________________________________ */
+#define RETH_PAYLD 15
+/* ___________________________________ */
+#define RETH_IMMDT_PAYLD 16
+/* ___________________________________ */
+#define RETH 17
+/* ___________________________________ */
+#define AETH_PAYLD 18
+/* ___________________________________ */
+#define AETH 19
+/* ___________________________________ */
+#define AETH_ATOMICACKETH 20
+/* ___________________________________ */
+#define ATOMICETH 21
+/* ___________________________________ */
+#define IETH_PAYLD 22
+/* ___________________________________ */
+
+
+/* Array of all availavle OpCodes to make matching a bit easier.
+* The OpCodes dictate the header sequence following in the packet.
+* These arrays tell the dissector which headers must be decoded for the given OpCode. */
+static guint32 opCode_RDETH_DETH_ATOMICETH[] = {
+ RD_CMP_SWAP,
+ RD_FETCH_ADD
+};
+static guint32 opCode_IETH_PAYLD[] = {
+ RC_SEND_LAST_INVAL,
+ RC_SEND_ONLY_INVAL
+};
+static guint32 opCode_ATOMICETH[] = {
+ RC_CMP_SWAP,
+ RC_FETCH_ADD
+};
+static guint32 opCode_RDETH_DETH_RETH_PAYLD[] = {
+ RD_RDMA_WRITE_FIRST,
+ RD_RDMA_WRITE_ONLY
+};
+static guint32 opCode_RETH_IMMDT_PAYLD[] = {
+ RC_RDMA_WRITE_ONLY_IMM,
+ UC_RDMA_WRITE_ONLY_IMM
+};
+static guint32 opCode_RDETH_DETH_IMMDT_PAYLD[] = {
+ RD_SEND_LAST_IMM,
+ RD_SEND_ONLY_IMM,
+ RD_RDMA_WRITE_LAST_IMM
+};
+
+static guint32 opCode_RDETH_AETH_PAYLD[] = {
+ RD_RDMA_READ_RESPONSE_FIRST,
+ RD_RDMA_READ_RESPONSE_LAST,
+ RD_RDMA_READ_RESPONSE_ONLY
+};
+static guint32 opCode_AETH_PAYLD[] = {
+ RC_RDMA_READ_RESPONSE_FIRST,
+ RC_RDMA_READ_RESPONSE_LAST,
+ RC_RDMA_READ_RESPONSE_ONLY
+};
+static guint32 opCode_RETH_PAYLD[] = {
+ RC_RDMA_WRITE_FIRST,
+ RC_RDMA_WRITE_ONLY,
+ UC_RDMA_WRITE_FIRST,
+ UC_RDMA_WRITE_ONLY
+};
+
+static guint32 opCode_RDETH_DETH_PAYLD[] = {
+ RD_SEND_FIRST,
+ RD_SEND_MIDDLE,
+ RD_SEND_LAST,
+ RD_SEND_ONLY,
+ RD_RDMA_WRITE_MIDDLE,
+ RD_RDMA_WRITE_LAST
+};
+
+static guint32 opCode_IMMDT_PAYLD[] = {
+ RC_SEND_LAST_IMM,
+ RC_SEND_ONLY_IMM,
+ RC_RDMA_WRITE_LAST_IMM,
+ UC_SEND_LAST_IMM,
+ UC_SEND_ONLY_IMM,
+ UC_RDMA_WRITE_LAST_IMM
+};
+
+static guint32 opCode_PAYLD[] = {
+ RC_SEND_FIRST,
+ RC_SEND_MIDDLE,
+ RC_SEND_LAST,
+ RC_SEND_ONLY,
+ RC_RDMA_WRITE_MIDDLE,
+ RC_RDMA_WRITE_LAST,
+ RC_RDMA_READ_RESPONSE_MIDDLE,
+ UC_SEND_FIRST,
+ UC_SEND_MIDDLE,
+ UC_SEND_LAST,
+ UC_SEND_ONLY,
+ UC_RDMA_WRITE_MIDDLE,
+ UC_RDMA_WRITE_LAST
+};
+
+/* It is not necessary to create arrays for these OpCodes since they indicate only one further header.
+* We can just decode it directly
+
+* static guint32 opCode_DETH_IMMDT_PAYLD[] = {
+* UD_SEND_ONLY_IMM
+* };
+* static guint32 opCode_DETH_PAYLD[] = {
+* UD_SEND_ONLY
+* };
+* static guint32 opCode_RDETH_DETH[] = {
+* RD_RESYNC
+* };
+* static guint32 opCode_RDETH_DETH_RETH[] = {
+* RD_RDMA_READ_REQUEST
+* };
+* static guint32 opCode_RDETH_DETH_RETH_IMMDT_PAYLD[] = {
+* RD_RDMA_WRITE_ONLY_IMM
+* };
+* static guint32 opCode_RDETH_AETH_ATOMICACKETH[] = {
+* RD_ATOMIC_ACKNOWLEDGE
+* };
+* static guint32 opCode_RDETH_AETH[] = {
+* RD_ACKNOWLEDGE
+* };
+* static guint32 opCode_RDETH_PAYLD[] = {
+* RD_RDMA_READ_RESPONSE_MIDDLE
+* };
+* static guint32 opCode_AETH_ATOMICACKETH[] = {
+* RC_ATOMIC_ACKNOWLEDGE
+* };
+* static guint32 opCode_RETH[] = {
+* RC_RDMA_READ_REQUEST
+* };
+* static guint32 opCode_AETH[] = {
+* RC_ACKNOWLEDGE
+* }; */
+
+
+/* Field dissector structures.
+* For reserved fields, reservedX denotes the reserved field is X bits in length.
+* e.g. reserved2 is a reserved field 2 bits in length.
+* The third parameter is a filter string associated for this field.
+* So for instance, to filter packets for a given virtual lane,
+* The filter (infiniband.LRH.vl == 3) or something similar would be used. */
+
+static hf_register_info hf[] = {
+
+ /* Local Route Header (LRH) */
+ {&hf_infiniband_LRH,
+ {"Local Route Header", "infiniband.lrh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_virtual_lane,
+ {"Virtual Lane", "infiniband.lrh.vl", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_link_version,
+ {"Link Version", "infiniband.lrh.lver", FT_UINT8, BASE_DEC, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_service_level,
+ {"Service Level", "infiniband.lrh.sl", FT_UINT8, BASE_DEC, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved2,
+ {"Reserved (2 bits)", "infiniband.lrh.reserved2", FT_UINT8, BASE_DEC, NULL, 0x0C, NULL, HFILL}
+ },
+ {&hf_infiniband_link_next_header,
+ {"Link Next Header", "infiniband.lrh.lnh", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
+ },
+ {&hf_infiniband_destination_local_id,
+ {"Destination Local ID", "infiniband.lrh.dlid", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved5,
+ {"Reserved (5 bits)", "infiniband.lrh.reserved5", FT_UINT16, BASE_DEC, NULL, 0xF800, NULL, HFILL}
+ },
+ {&hf_infiniband_packet_length,
+ {"Packet Length", "infiniband.lrh.pktlen", FT_UINT16, BASE_DEC, NULL, 0x07FF, NULL, HFILL}
+ },
+ {&hf_infiniband_source_local_id,
+ {"Source Local ID", "infiniband.lrh.slid", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+
+ /* Global Route Header (GRH) */
+ {&hf_infiniband_GRH,
+ {"Global Route Header", "infiniband.grh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ip_version,
+ {"IP Version", "infiniband.grh.ipver", FT_UINT8, BASE_DEC, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_traffic_class,
+ {"Traffic Class", "infiniband.grh.tclass", FT_UINT16, BASE_DEC, NULL, 0x0FF0, NULL, HFILL}
+ },
+ {&hf_infiniband_flow_label,
+ {"Flow Label", "infiniband.grh.flowlabel", FT_UINT32, BASE_DEC, NULL, 0x000FFFFF, NULL, HFILL}
+ },
+ {&hf_infiniband_payload_length,
+ {"Payload Length", "infiniband.grh.paylen", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_next_header,
+ {"Next Header", "infiniband.grh.nxthdr", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_hop_limit,
+ {"Hop Limit", "infiniband.grh.hoplmt", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_source_gid,
+ {"Source GID", "infiniband.grh.sgid", FT_IPv6, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_destination_gid,
+ {"Destination GID", "infiniband.grh.dgid", FT_IPv6, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+
+ /* Base Transport Header (BTH) */
+ {&hf_infiniband_BTH,
+ {"Base Transport Header", "infiniband.bth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_opcode,
+ {"Opcode", "infiniband.bth.opcode", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_solicited_event,
+ {"Solicited Event", "infiniband.bth.se", FT_BOOLEAN, BASE_DEC, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_migreq,
+ {"MigReq", "infiniband.bth.m", FT_BOOLEAN, BASE_DEC, NULL, 0x40, NULL, HFILL}
+ },
+ {&hf_infiniband_pad_count,
+ {"Pad Count", "infiniband.bth.padcnt", FT_UINT8, BASE_DEC, NULL, 0x30, NULL, HFILL}
+ },
+ {&hf_infiniband_transport_header_version,
+ {"Header Version", "infiniband.bth.tver", FT_UINT8, BASE_DEC, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_partition_key,
+ {"Partition Key", "infiniband.bth.p_key", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved8,
+ {"Reserved (8 bits)", "infiniband.bth.reserved8", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_destination_qp,
+ {"Destination Queue Pair", "infiniband.bth.destqp", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_acknowledge_request,
+ {"Acknowledge Request", "infiniband.bth.a", FT_BOOLEAN, BASE_DEC, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved7,
+ {"Reserved (7 bits)", "infiniband.bth.reserved7", FT_UINT8, BASE_DEC, NULL, 0x7F, NULL, HFILL}
+ },
+ {&hf_infiniband_packet_sequence_number,
+ {"Packet Sequence Number", "infiniband.bth.psn", FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+
+ /* Raw Header (RWH) */
+ {&hf_infiniband_RWH,
+ {"Raw Header", "infiniband.rwh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved16_RWH,
+ {"Reserved (16 bits)", "infiniband.rwh.reserved", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_etype,
+ {"Ethertype", "infiniband.rwh.etype", FT_UINT16, BASE_HEX, NULL /*VALS(etype_vals)*/, 0x0, "Type", HFILL }
+ },
+
+ /* Reliable Datagram Extended Transport Header (RDETH) */
+ {&hf_infiniband_RDETH,
+ {"Reliable Datagram Extended Transport Header", "infiniband.rdeth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved8_RDETH,
+ {"Reserved (8 bits)", "infiniband.rdeth.reserved8", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ee_context,
+ {"E2E Context", "infiniband.rdeth.eecnxt", FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+
+ /* Datagram Extended Transport Header (DETH) */
+ {&hf_infiniband_DETH,
+ {"Datagram Extended Transport Header", "infiniband.deth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_queue_key,
+ {"Queue Key", "infiniband.deth.q_key", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved8_DETH,
+ {"Reserved (8 bits)", "infiniband.deth.reserved8", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_source_qp,
+ {"Source Queue Pair", "infiniband.deth.srcqp", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+
+ /* RDMA Extended Transport Header (RETH) */
+ {&hf_infiniband_RETH,
+ {"RDMA Extended Transport Header", "infiniband.reth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_virtual_address,
+ {"Virtual Address", "infiniband.reth.va", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_remote_key,
+ {"Remote Key", "infiniband.reth.r_key", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_dma_length,
+ {"DMA Length", "infiniband.reth.dmalen", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+
+ /* Atomic Extended Transport Header (AtomicETH) */
+ {&hf_infiniband_AtomicETH,
+ {"Atomic Extended Transport Header", "infiniband.atomiceth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_virtual_address_AtomicETH,
+ {"Virtual Address", "infiniband.atomiceth.va", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_remote_key_AtomicETH,
+ {"Remote Key", "infiniband.atomiceth.r_key", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_swap_or_add_data,
+ {"Swap (Or Add) Data", "infiniband.atomiceth.swapdt", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_compare_data,
+ {"Compare Data", "infiniband.atomiceth.cmpdt", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+
+ /* ACK Extended Transport Header (AETH) */
+ {&hf_infiniband_AETH,
+ {"ACK Extended Transport Header", "infiniband.aeth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_syndrome,
+ {"Syndrome", "infiniband.aeth.syndrome", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_message_sequence_number,
+ {"Message Sequence Number", "infiniband.aeth.msn", FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+
+ /* Atomic ACK Extended Transport Header (AtomicAckETH) */
+ {&hf_infiniband_AtomicAckETH,
+ {"Atomic ACK Extended Transport Header", "infiniband.atomicacketh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_original_remote_data,
+ {"Original Remote Data", "infiniband.atomicacketh.origremdt", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
+ },
+ /* Immediate Extended Transport Header (ImmDT) */
+ {&hf_infiniband_IMMDT,
+ {"Immediate Data", "infiniband.immdt", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+
+ /* Invalidate Extended Transport Header (IETH) */
+ {&hf_infiniband_IETH,
+ {"RKey", "infiniband.ieth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+
+ /* Payload */
+ {&hf_infiniband_payload,
+ {"Payload", "infiniband.payload", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_invariant_crc,
+ {"Invariant CRC", "infiniband.invariant.crc", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_variant_crc,
+ {"Variant CRC", "infiniband.variant.crc", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_raw_data,
+ {"Raw Data", "infiniband.rawdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* Unknown or Vendor Specific */
+ {&hf_infiniband_vendor,
+ {"Unknown/Vendor Specific Data", "infiniband.vendor", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+
+ /* MAD Base Header */
+ {&hf_infiniband_MAD,
+ {"MAD (Management Datagram) Common Header", "infiniband.mad", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_base_version,
+ {"Base Version", "infiniband.mad.baseversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_mgmt_class,
+ {"Management Class", "infiniband.mad.mgmtclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_class_version,
+ {"Class Version", "infiniband.mad.classversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved1,
+ {"Reserved", "infiniband.mad.reserved1", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_method,
+ {"Method", "infiniband.mad.method", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
+ },
+ {&hf_infiniband_status,
+ {"Status", "infiniband.mad.status", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_class_specific,
+ {"Class Specific", "infiniband.mad.classspecific", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_transaction_id,
+ {"Transaction ID", "infiniband.mad.transactionid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_attribute_id,
+ {"Attribute ID", "infiniband.mad.attributeid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved16,
+ {"Reserved", "infiniband.mad.reserved16", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_attribute_modifier,
+ {"Attribute Modifier", "infiniband.mad.attributemodifier", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_data,
+ {"MAD Data Payload", "infiniband.mad.data", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* RMPP Header */
+ {&hf_infiniband_RMPP,
+ {"RMPP (Reliable Multi-Packet Transaction Protocol)", "infiniband.rmpp", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_rmpp_version,
+ {"RMPP Type", "infiniband.rmpp.rmppversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_rmpp_type,
+ {"RMPP Type", "infiniband.rmpp.rmpptype", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_r_resp_time,
+ {"R Resp Time", "infiniband.rmpp.rresptime", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_rmpp_flags,
+ {"RMPP Flags", "infiniband.rmpp.rmppflags", FT_UINT8, BASE_HEX, VALS(RMPP_Flags), 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_rmpp_status,
+ {"RMPP Status", "infiniband.rmpp.rmppstatus", FT_UINT8, BASE_HEX, VALS(RMPP_Status), 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_rmpp_data1,
+ {"RMPP Data 1", "infiniband.rmpp.data1", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_rmpp_data2,
+ {"RMPP Data 2", "infiniband.rmpp.data2", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* RMPP Data */
+ {&hf_infiniband_RMPP_DATA,
+ {"RMPP Data (Reliable Multi-Packet Transaction Protocol)", "infiniband.rmpp.data", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_segment_number,
+ {"Segment Number", "infiniband.rmpp.segmentnumber", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_payload_length32,
+ {"Payload Length", "infiniband.rmpp.payloadlength", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_transferred_data,
+ {"Transferred Data", "infiniband.rmpp.transferreddata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* RMPP ACK */
+ {&hf_infiniband_new_window_last,
+ {"New Window Last", "infiniband.rmpp.newwindowlast", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved220,
+ {"Segment Number", "infiniband.rmpp.reserved220", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* RMPP ABORT/STOP */
+ {&hf_infiniband_optional_extended_error_data,
+ {"Optional Extended Error Data", "infiniband.rmpp.extendederrordata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* SMP Data (LID Routed) */
+ {&hf_infiniband_SMP_LID,
+ {"Subnet Management Packet (LID Routed)", "infiniband.smplid", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_m_key,
+ {"M_Key", "infiniband.smplid.mkey", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_smp_data,
+ {"SMP Data", "infiniband.smplid.smpdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved1024,
+ {"Reserved (1024 bits)", "infiniband.smplid.reserved1024", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved256,
+ {"Reserved (256 bits)", "infiniband.smplid.reserved256", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* SMP Data Directed Route */
+ {&hf_infiniband_SMP_DIRECTED,
+ {"Subnet Management Packet (Directed Route)", "infiniband.smpdirected", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_smp_status,
+ {"Status", "infiniband.smpdirected.smpstatus", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_hop_pointer,
+ {"Hop Pointer", "infiniband.smpdirected.hoppointer", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_hop_count,
+ {"Hop Count", "infiniband.smpdirected.hopcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_dr_slid,
+ {"DrSLID", "infiniband.smpdirected.drslid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_dr_dlid,
+ {"DrDLID", "infiniband.smpdirected.drdlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_reserved28,
+ {"Reserved (224 bits)", "infiniband.smpdirected.reserved28", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_d,
+ {"D (Direction Bit)", "infiniband.smpdirected.d", FT_UINT64, BASE_HEX, NULL, 0x8000, NULL, HFILL}
+ },
+ {&hf_infiniband_initial_path,
+ {"Initial Path", "infiniband.smpdirected.initialpath", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_return_path,
+ {"Return Path", "infiniband.smpdirected.returnpath", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* SA MAD Header */
+ {&hf_infiniband_SA,
+ {"SA Packet (Subnet Administration)", "infiniband.sa.drdlid", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_sm_key,
+ {"SM_Key (Verification Key)", "infiniband.sa.smkey", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_attribute_offset,
+ {"Attribute Offset", "infiniband.sa.attributeoffset", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_component_mask,
+ {"Component Mask", "infiniband.sa.componentmask", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_subnet_admin_data,
+ {"Subnet Admin Data", "infiniband.sa.subnetadmindata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* NodeDescription */
+ {&hf_infiniband_NodeDescription_NodeString,
+ {"NodeString", "infiniband.nodedescription.nodestring", FT_STRING, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* NodeInfo */
+ {&hf_infiniband_NodeInfo_BaseVersion,
+ {"BaseVersion", "infiniband.nodeinfo.baseversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_ClassVersion,
+ {"ClassVersion", "infiniband.nodeinfo.classversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_NodeType,
+ {"NodeType", "infiniband.nodeinfo.nodetype", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_NumPorts,
+ {"NumPorts", "infiniband.nodeinfo.numports", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_SystemImageGUID,
+ {"SystemImageGUID", "infiniband.nodeinfo.systemimageguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_NodeGUID,
+ {"NodeGUID", "infiniband.nodeinfo.nodeguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_PortGUID,
+ {"PortGUID", "infiniband.nodeinfo.portguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_PartitionCap,
+ {"PartitionCap", "infiniband.nodeinfo.partitioncap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_DeviceID,
+ {"DeviceID", "infiniband.nodeinfo.deviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_Revision,
+ {"Revision", "infiniband.nodeinfo.revision", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_LocalPortNum,
+ {"LocalPortNum", "infiniband.nodeinfo.localportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_NodeInfo_VendorID,
+ {"VendorID", "infiniband.nodeinfo.vendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* SwitchInfo */
+ {&hf_infiniband_SwitchInfo_LinearFDBCap,
+ {"LinearFDBCap", "infiniband.switchinfo.linearfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_RandomFDBCap,
+ {"RandomFDBCap", "infiniband.switchinfo.randomfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_MulticastFDBCap,
+ {"MulticastFDBCap", "infiniband.switchinfo.multicastfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_LinearFDBTop,
+ {"LinearFDBTop", "infiniband.switchinfo.linearfdbtop", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_DefaultPort,
+ {"DefaultPort", "infiniband.switchinfo.defaultport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort,
+ {"DefaultMulticastPrimaryPort", "infiniband.switchinfo.defaultmulticastprimaryport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort,
+ {"DefaultMulticastNotPrimaryPort", "infiniband.switchinfo.defaultmulticastnotprimaryport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_LifeTimeValue,
+ {"LifeTimeValue", "infiniband.switchinfo.lifetimevalue", FT_UINT8, BASE_HEX, NULL, 0xF8, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_PortStateChange,
+ {"PortStateChange", "infiniband.switchinfo.portstatechange", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming,
+ {"OptimizedSLtoVLMappingProgramming", "infiniband.switchinfo.optimizedsltovlmappingprogramming", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_LIDsPerPort,
+ {"LIDsPerPort", "infiniband.switchinfo.lidsperport", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_PartitionEnforcementCap,
+ {"PartitionEnforcementCap", "infiniband.switchinfo.partitionenforcementcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_InboundEnforcementCap,
+ {"InboundEnforcementCap", "infiniband.switchinfo.inboundenforcementcap", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_OutboundEnforcementCap,
+ {"OutboundEnforcementCap", "infiniband.switchinfo.outboundenforcementcap", FT_UINT8, BASE_HEX, NULL, 0x40, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_FilterRawInboundCap,
+ {"FilterRawInboundCap", "infiniband.switchinfo.filterrawinboundcap", FT_UINT8, BASE_HEX, NULL, 0x20, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_FilterRawOutboundCap,
+ {"FilterRawOutboundCap", "infiniband.switchinfo.filterrawoutboundcap", FT_UINT8, BASE_HEX, NULL, 0x10, NULL, HFILL}
+ },
+ {&hf_infiniband_SwitchInfo_EnhancedPortZero,
+ {"EnhancedPortZero", "infiniband.switchinfo.enhancedportzero", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
+ },
+ /* GUIDInfo */
+ {&hf_infiniband_GUIDInfo_GUIDBlock,
+ {"GUIDBlock", "infiniband.switchinfo.guidblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_GUIDInfo_GUID,
+ {"GUID", "infiniband.switchinfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* PortInfo */
+ {&hf_infiniband_PortInfo_M_Key,
+ {"M_Key", "infiniband.portinfo.m_key", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_GidPrefix,
+ {"GidPrefix", "infiniband.portinfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LID,
+ {"LID", "infiniband.portinfo.lid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_MasterSMLID,
+ {"MasterSMLID", "infiniband.portinfo.mastersmlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask,
+ {"CapabilityMask", "infiniband.portinfo.capabilitymask", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+
+ /* Capability Mask Flags */
+ {&hf_infiniband_PortInfo_CapabilityMask_SM,
+ {"SM", "infiniband.portinfo.capabilitymask.issm", FT_UINT32, BASE_HEX, NULL, 0x0000002, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_NoticeSupported,
+ {"NoticeSupported", "infiniband.portinfo.capabilitymask.noticesupported", FT_UINT32, BASE_HEX, NULL, 0x0000004, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_TrapSupported,
+ {"TrapSupported", "infiniband.portinfo.capabilitymask.trapsupported", FT_UINT32, BASE_HEX, NULL, 0x0000008, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported,
+ {"OptionalPDSupported", "infiniband.portinfo.capabilitymask.optionalpdsupported", FT_UINT32, BASE_HEX, NULL, 0x0000010, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported,
+ {"AutomaticMigrationSupported", "infiniband.portinfo.capabilitymask.automaticmigrationsupported", FT_UINT32, BASE_HEX, NULL, 0x0000020, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported,
+ {"SLMappingSupported", "infiniband.portinfo.capabilitymask.slmappingsupported", FT_UINT32, BASE_HEX, NULL, 0x0000040, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM,
+ {"MKeyNVRAM", "infiniband.portinfo.capabilitymask.mkeynvram", FT_UINT32, BASE_HEX, NULL, 0x0000080, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM,
+ {"PKeyNVRAM", "infiniband.portinfo.capabilitymask.pkeynvram", FT_UINT32, BASE_HEX, NULL, 0x0000100, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported,
+ {"LEDInfoSupported", "infiniband.portinfo.capabilitymask.ledinfosupported", FT_UINT32, BASE_HEX, NULL, 0x0000200, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_SMdisabled,
+ {"SMdisabled", "infiniband.portinfo.capabilitymask.smdisabled", FT_UINT32, BASE_HEX, NULL, 0x0000400, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported,
+ {"SystemImageGUIDSupported", "infiniband.portinfo.capabilitymask.systemimageguidsupported", FT_UINT32, BASE_HEX, NULL, 0x0000800, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported,
+ {"PKeySwitchExternalPortTrapSupported", "infiniband.portinfo.capabilitymask.pkeyswitchexternalporttrapsupported", FT_UINT32, BASE_HEX, NULL, 0x0001000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported,
+ {"CommunicationsManagementSupported", "infiniband.portinfo.capabilitymask.communicationsmanagementsupported", FT_UINT32, BASE_HEX, NULL, 0x0010000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported,
+ {"SNMPTunnelingSupported", "infiniband.portinfo.capabilitymask.snmptunnelingsupported", FT_UINT32, BASE_HEX, NULL, 0x0020000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_ReinitSupported,
+ {"ReinitSupported", "infiniband.portinfo.capabilitymask.reinitsupported", FT_UINT32, BASE_HEX, NULL, 0x0040000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported,
+ {"DeviceManagementSupported", "infiniband.portinfo.capabilitymask.devicemanagementsupported", FT_UINT32, BASE_HEX, NULL, 0x0080000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported,
+ {"VendorClassSupported", "infiniband.portinfo.capabilitymask.vendorclasssupported", FT_UINT32, BASE_HEX, NULL, 0x0100000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported,
+ {"DRNoticeSupported", "infiniband.portinfo.capabilitymask.drnoticesupported", FT_UINT32, BASE_HEX, NULL, 0x0200000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported,
+ {"CapabilityMaskNoticeSupported", "infiniband.portinfo.capabilitymask.capabilitymasknoticesupported", FT_UINT32, BASE_HEX, NULL, 0x0400000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported,
+ {"BootManagementSupported", "infiniband.portinfo.capabilitymask.bootmanagementsupported", FT_UINT32, BASE_HEX, NULL, 0x0800000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported,
+ {"LinkRoundTripLatencySupported", "infiniband.portinfo.capabilitymask.linkroundtriplatencysupported", FT_UINT32, BASE_HEX, NULL, 0x01000000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported,
+ {"ClientRegistrationSupported", "infiniband.portinfo.capabilitymask.clientregistrationsupported", FT_UINT32, BASE_HEX, NULL, 0x02000000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported,
+ {"OtherLocalChangesNoticeSupported", "infiniband.portinfo.capabilitymask.otherlocalchangesnoticesupported", FT_UINT32, BASE_HEX, NULL, 0x04000000, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported,
+ {"LinkSpeedWIdthPairsTableSupported", "infiniband.portinfo.capabilitymask.linkspeedwidthpairstablesupported", FT_UINT32, BASE_HEX, NULL, 0x08000000, NULL, HFILL}
+ },
+ /* End Capability Mask Flags */
+
+ {&hf_infiniband_PortInfo_DiagCode,
+ {"DiagCode", "infiniband.portinfo.diagcode", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_M_KeyLeasePeriod,
+ {"M_KeyLeasePeriod", "infiniband.portinfo.m_keyleaseperiod", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LocalPortNum,
+ {"LocalPortNum", "infiniband.portinfo.localportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkWidthEnabled,
+ {"LinkWidthEnabled", "infiniband.portinfo.linkwidthenabled", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkWidthSupported,
+ {"LinkWidthSupported", "infiniband.portinfo.linkwidthsupported", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkWidthActive,
+ {"LinkWidthActive", "infiniband.portinfo.linkwidthactive", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkSpeedSupported,
+ {"LinkSpeedSupported", "infiniband.portinfo.linkspeedsupported", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_PortState,
+ {"PortState", "infiniband.portinfo.portstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_PortPhysicalState,
+ {"PortPhysicalState", "infiniband.portinfo.portphysicalstate", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkDownDefaultState,
+ {"LinkDownDefaultState", "infiniband.portinfo.linkdowndefaultstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_M_KeyProtectBits,
+ {"M_KeyProtectBits", "infiniband.portinfo.m_keyprotectbits", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LMC,
+ {"LMC", "infiniband.portinfo.lmc", FT_UINT8, BASE_HEX, NULL, 0x07, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkSpeedActive,
+ {"LinkSpeedActive", "infiniband.portinfo.linkspeedactive", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkSpeedEnabled,
+ {"LinkSpeedEnabled", "infiniband.portinfo.linkspeedenabled", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_NeighborMTU,
+ {"NeighborMTU", "infiniband.portinfo.neighbormtu", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_MasterSMSL,
+ {"MasterSMSL", "infiniband.portinfo.mastersmsl", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_VLCap,
+ {"VLCap", "infiniband.portinfo.vlcap", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_InitType,
+ {"InitType", "infiniband.portinfo.inittype", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_VLHighLimit,
+ {"VLHighLimit", "infiniband.portinfo.vlhighlimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_VLArbitrationHighCap,
+ {"VLArbitrationHighCap", "infiniband.portinfo.vlarbitrationhighcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_VLArbitrationLowCap,
+ {"VLArbitrationLowCap", "infiniband.portinfo.vlarbitrationlowcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_InitTypeReply,
+ {"InitTypeReply", "infiniband.portinfo.inittypereply", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_MTUCap,
+ {"MTUCap", "infiniband.portinfo.mtucap", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_VLStallCount,
+ {"VLStallCount", "infiniband.portinfo.vlstallcount", FT_UINT8, BASE_HEX, NULL, 0xE0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_HOQLife,
+ {"HOQLife", "infiniband.portinfo.hoqlife", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_OperationalVLs,
+ {"OperationalVLs", "infiniband.portinfo.operationalvls", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_PartitionEnforcementInbound,
+ {"PartitionEnforcementInbound", "infiniband.portinfo.partitionenforcementinbound", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_PartitionEnforcementOutbound,
+ {"PartitionEnforcementOutbound", "infiniband.portinfo.partitionenforcementoutbound", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_FilterRawInbound,
+ {"FilterRawInbound", "infiniband.portinfo.filterrawinbound", FT_UINT8, BASE_HEX, NULL, 0x02, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_FilterRawOutbound,
+ {"FilterRawOutbound", "infiniband.portinfo.filterrawoutbound", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_M_KeyViolations,
+ {"M_KeyViolations", "infiniband.portinfo.m_keyviolations", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_P_KeyViolations,
+ {"P_KeyViolations", "infiniband.portinfo.p_keyviolations", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_Q_KeyViolations,
+ {"Q_KeyViolations", "infiniband.portinfo.q_keyviolations", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_GUIDCap,
+ {"GUIDCap", "infiniband.portinfo.guidcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_ClientReregister,
+ {"ClientReregister", "infiniband.portinfo.clientreregister", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_SubnetTimeOut,
+ {"SubnetTimeOut", "infiniband.portinfo.subnettimeout", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_RespTimeValue,
+ {"RespTimeValue", "infiniband.portinfo.resptimevalue", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LocalPhyErrors,
+ {"LocalPhyErrors", "infiniband.portinfo.localphyerrors", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_OverrunErrors,
+ {"OverrunErrors", "infiniband.portinfo.overrunerrors", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_MaxCreditHint,
+ {"MaxCreditHint", "infiniband.portinfo.maxcredithint", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PortInfo_LinkRoundTripLatency,
+ {"LinkRoundTripLatency", "infiniband.portinfo.linkroundtriplatency", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* P_KeyTable */
+ {&hf_infiniband_P_KeyTable_P_KeyTableBlock,
+ {"P_KeyTableBlock", "infiniband.p_keytable.p_keytableblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_P_KeyTable_MembershipType,
+ {"MembershipType", "infiniband.p_keytable.membershiptype", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_P_KeyTable_P_KeyBase,
+ {"P_KeyBase", "infiniband.p_keytable.p_keybase", FT_UINT16, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
+ },
+ /* SLtoVLMappingTable */
+ {&hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits,
+ {"SL(x)toVL", "infiniband.sltovlmappingtable.sltovlhighbits", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits,
+ {"SL(x)toVL", "infiniband.sltovlmappingtable.sltovllowbits", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ /* VLArbitrationTable */
+ {&hf_infiniband_VLArbitrationTable_VLWeightPairs,
+ {"VLWeightPairs", "infiniband.vlarbitrationtable.vlweightpairs", FT_BYTES, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
+ },
+ {&hf_infiniband_VLArbitrationTable_VL,
+ {"VL", "infiniband.vlarbitrationtable.vl", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_VLArbitrationTable_Weight,
+ {"Weight", "infiniband.vlarbitrationtable.weight", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* LinearForwardingTable */
+ {&hf_infiniband_LinearForwardingTable_LinearForwardingTableBlock,
+ {"LinearForwardingTableBlock", "infiniband.linearforwardingtable.linearforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_LinearForwardingTable_Port,
+ {"Port", "infiniband.linearforwardingtable.port", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* RandomForwardingTable */
+ {&hf_infiniband_RandomForwardingTable_RandomForwardingTableBlock,
+ {"RandomForwardingTableBlock", "infiniband.randomforwardingtable.randomforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
+ },
+ {&hf_infiniband_RandomForwardingTable_LID,
+ {"LID", "infiniband.randomforwardingtable.lid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_RandomForwardingTable_Valid,
+ {"Valid", "infiniband.randomforwardingtable.valid", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_RandomForwardingTable_LMC,
+ {"LMC", "infiniband.randomforwardingtable.lmc", FT_UINT16, BASE_HEX, NULL, 0x70, NULL, HFILL}
+ },
+ {&hf_infiniband_RandomForwardingTable_Port,
+ {"Port", "infiniband.randomforwardingtable.port", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* MulticastForwardingTable */
+ {&hf_infiniband_MulticastForwardingTable_MulticastForwardingTableBlock ,
+ {"MulticastForwardingTableBlock ", "infiniband.multicastforwardingtable.multicastforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MulticastForwardingTable_PortMask,
+ {"PortMask", "infiniband.multicastforwardingtable.portmask", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* SMInfo */
+ {&hf_infiniband_SMInfo_GUID,
+ {"GUID", "infiniband.sminfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SMInfo_SM_Key,
+ {"SM_Key", "infiniband.sminfo.sm_key", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SMInfo_ActCount,
+ {"ActCount", "infiniband.sminfo.actcount", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SMInfo_Priority,
+ {"Priority", "infiniband.sminfo.priority", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_SMInfo_SMState,
+ {"SMState", "infiniband.sminfo.smstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ /* VendorDiag */
+ {&hf_infiniband_VendorDiag_NextIndex,
+ {"NextIndex", "infiniband.vendordiag.nextindex", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_VendorDiag_DiagData,
+ {"DiagData", "infiniband.vendordiag.diagdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* LedInfo */
+ {&hf_infiniband_LedInfo_LedMask,
+ {"LedMask", "infiniband.ledinfo.ledmask", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ /* LinkSpeedWidthPairsTable */
+ {&hf_infiniband_LinkSpeedWidthPairsTable_NumTables,
+ {"NumTables", "infiniband.linkspeedwidthpairstable.numtables", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_LinkSpeedWidthPairsTable_PortMask,
+ {"PortMask", "infiniband.linkspeedwidthpairstable.portmask", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive,
+ {"Speed 2.5 Gbps", "infiniband.linkspeedwidthpairstable.speedtwofive", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive,
+ {"Speed 5 Gbps", "infiniband.linkspeedwidthpairstable.speedfive", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen,
+ {"Speed 10 Gbps", "infiniband.linkspeedwidthpairstable.speedten", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ /* NodeRecord */
+ /* PortInfoRecord */
+ /* SLtoVLMappingTableRecord */
+ /* SwitchInfoRecord */
+ /* LinearForwardingTableRecord */
+ /* RandomForwardingTableRecord */
+ /* MulticastForwardingTableRecord */
+ /* VLArbitrationTableRecord */
+ {&hf_infiniband_SA_LID,
+ {"LID", "infiniband.sa.lid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_EndportLID,
+ {"EndportLID", "infiniband.sa.endportlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_PortNum,
+ {"PortNum", "infiniband.sa.portnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_InputPortNum ,
+ {"InputPortNum ", "infiniband.sa.inputportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_OutputPortNum,
+ {"OutputPortNum", "infiniband.sa.outputportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_BlockNum_EightBit,
+ {"BlockNum_EightBit", "infiniband.sa.blocknum_eightbit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_BlockNum_NineBit,
+ {"BlockNum_NineBit", "infiniband.sa.blocknum_ninebit", FT_UINT16, BASE_HEX, NULL, 0x01FF, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_BlockNum_SixteenBit,
+ {"BlockNum_SixteenBit", "infiniband.sa.blocknum_sixteenbit", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_Position,
+ {"Position", "infiniband.sa.position", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_SA_Index,
+ {"Index", "infiniband.sa.index", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* InformInfoRecord */
+ {&hf_infiniband_InformInfoRecord_SubscriberGID,
+ {"SubscriberGID", "infiniband.informinforecord.subscribergid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfoRecord_Enum,
+ {"Enum", "infiniband.informinforecord.enum", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* InformInfo */
+ {&hf_infiniband_InformInfo_GID,
+ {"GID", "infiniband.informinfo.gid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_LIDRangeBegin,
+ {"LIDRangeBegin", "infiniband.informinfo.lidrangebegin", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_LIDRangeEnd,
+ {"LIDRangeEnd", "infiniband.informinfo.lidrangeend", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_IsGeneric,
+ {"IsGeneric", "infiniband.informinfo.isgeneric", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_Subscribe,
+ {"Subscribe", "infiniband.informinfo.subscribe", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_Type,
+ {"Type", "infiniband.informinfo.type", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_TrapNumberDeviceID,
+ {"TrapNumberDeviceID", "infiniband.informinfo.trapnumberdeviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_QPN,
+ {"QPN", "infiniband.informinfo.qpn", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_RespTimeValue,
+ {"RespTimeValue", "infiniband.informinfo.resptimevalue", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
+ },
+ {&hf_infiniband_InformInfo_ProducerTypeVendorID,
+ {"ProducerTypeVendorID", "infiniband.informinfo.producertypevendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* LinkRecord */
+ {&hf_infiniband_LinkRecord_FromLID,
+ {"FromLID", "infiniband.linkrecord.fromlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_LinkRecord_FromPort,
+ {"FromPort", "infiniband.linkrecord.fromport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_LinkRecord_ToPort,
+ {"ToPort", "infiniband.linkrecord.toport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_LinkRecord_ToLID,
+ {"ToLID", "infiniband.linkrecord.tolid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* ServiceRecord */
+ {&hf_infiniband_ServiceRecord_ServiceID,
+ {"ServiceID", "infiniband.linkrecord.serviceid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ServiceRecord_ServiceGID,
+ {"ServiceGID", "infiniband.linkrecord.servicegid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ServiceRecord_ServiceP_Key,
+ {"ServiceP_Key", "infiniband.linkrecord.servicep_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ServiceRecord_ServiceLease,
+ {"ServiceLease", "infiniband.linkrecord.servicelease", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ServiceRecord_ServiceKey,
+ {"ServiceKey", "infiniband.linkrecord.servicekey", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ServiceRecord_ServiceName,
+ {"ServiceName", "infiniband.linkrecord.servicename", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ServiceRecord_ServiceData,
+ {"ServiceData", "infiniband.linkrecord.servicedata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* ServiceAssociationRecord */
+ {&hf_infiniband_ServiceAssociationRecord_ServiceKey,
+ {"ServiceKey", "infiniband.serviceassociationrecord.servicekey", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_ServiceAssociationRecord_ServiceName,
+ {"ServiceName", "infiniband.serviceassociationrecord.servicename", FT_STRING, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* PathRecord */
+ {&hf_infiniband_PathRecord_DGID,
+ {"DGID", "infiniband.pathrecord.dgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_SGID,
+ {"SGID", "infiniband.pathrecord.sgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_DLID,
+ {"DLID", "infiniband.pathrecord.dlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_SLID,
+ {"SLID", "infiniband.pathrecord.slid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_RawTraffic,
+ {"RawTraffic", "infiniband.pathrecord.rawtraffic", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_FlowLabel,
+ {"FlowLabel", "infiniband.pathrecord.flowlabel", FT_UINT24, BASE_HEX, NULL, 0xFFFFF0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_HopLimit,
+ {"HopLimit", "infiniband.pathrecord.hoplimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_TClass,
+ {"TClass", "infiniband.pathrecord.tclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_Reversible,
+ {"Reversible", "infiniband.pathrecord.reversible", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_NumbPath,
+ {"NumbPath", "infiniband.pathrecord.numbpath", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_P_Key,
+ {"P_Key", "infiniband.pathrecord.p_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_SL,
+ {"SL", "infiniband.pathrecord.sl", FT_UINT16, BASE_HEX, NULL, 0x000F, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_MTUSelector,
+ {"MTUSelector", "infiniband.pathrecord.mtuselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_MTU,
+ {"MTU", "infiniband.pathrecord.mtu", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_RateSelector,
+ {"RateSelector", "infiniband.pathrecord.rateselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_Rate,
+ {"Rate", "infiniband.pathrecord.rate", FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_PacketLifeTimeSelector,
+ {"PacketLifeTimeSelector", "infiniband.pathrecord.packetlifetimeselector", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_PacketLifeTime,
+ {"PacketLifeTime", "infiniband.pathrecord.packetlifetime", FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL}
+ },
+ {&hf_infiniband_PathRecord_Preference,
+ {"Preference", "infiniband.pathrecord.preference", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* MCMemberRecord */
+ {&hf_infiniband_MCMemberRecord_MGID,
+ {"MGID", "infiniband.mcmemberrecord.mgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_PortGID,
+ {"PortGID", "infiniband.mcmemberrecord.portgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_Q_Key,
+ {"Q_Key", "infiniband.mcmemberrecord.q_key", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_MLID,
+ {"MLID", "infiniband.mcmemberrecord.mlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_MTUSelector,
+ {"MTUSelector", "infiniband.mcmemberrecord.mtuselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_MTU,
+ {"MTU", "infiniband.mcmemberrecord.mtu", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_TClass,
+ {"TClass", "infiniband.mcmemberrecord.tclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_P_Key,
+ {"P_Key", "infiniband.mcmemberrecord.p_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_RateSelector,
+ {"RateSelector", "infiniband.mcmemberrecord.rateselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_Rate,
+ {"Rate", "infiniband.mcmemberrecord.rate", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_PacketLifeTimeSelector,
+ {"PacketLifeTimeSelector", "infiniband.mcmemberrecord.packetlifetimeselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_PacketLifeTime,
+ {"PacketLifeTime", "infiniband.mcmemberrecord.packetlifetime", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_SL,
+ {"SL", "infiniband.mcmemberrecord.sl", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_FlowLabel,
+ {"FlowLabel", "infiniband.mcmemberrecord.flowlabel", FT_UINT24, BASE_HEX, NULL, 0x0FFFFF, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_HopLimit,
+ {"HopLimit", "infiniband.mcmemberrecord.hoplimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_Scope,
+ {"Scope", "infiniband.mcmemberrecord.scope", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_JoinState,
+ {"JoinState", "infiniband.mcmemberrecord.joinstate", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
+ },
+ {&hf_infiniband_MCMemberRecord_ProxyJoin,
+ {"ProxyJoin", "infiniband.mcmemberrecord.proxyjoin", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
+ },
+ /* MultiPathRecord */
+ {&hf_infiniband_MultiPathRecord_RawTraffic,
+ {"RawTraffic", "infiniband.multipathrecord.rawtraffic", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_FlowLabel,
+ {"FlowLabel", "infiniband.multipathrecord.flowlabel", FT_UINT24, BASE_HEX, NULL, 0x0FFFFF, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_HopLimit,
+ {"HopLimit", "infiniband.multipathrecord.hoplimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_TClass,
+ {"TClass", "infiniband.multipathrecord.tclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_Reversible,
+ {"Reversible", "infiniband.multipathrecord.reversible", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_NumbPath,
+ {"NumbPath", "infiniband.multipathrecord.numbpath", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_P_Key,
+ {"P_Key", "infiniband.multipathrecord.p_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_SL,
+ {"SL", "infiniband.multipathrecord.sl", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_MTUSelector,
+ {"MTUSelector", "infiniband.multipathrecord.mtuselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_MTU,
+ {"MTU", "infiniband.multipathrecord.mtu", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_RateSelector,
+ {"RateSelector", "infiniband.multipathrecord.rateselector", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_Rate,
+ {"Rate", "infiniband.multipathrecord.rate", FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_PacketLifeTimeSelector,
+ {"PacketLifeTimeSelector", "infiniband.multipathrecord.packetlifetimeselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_PacketLifeTime,
+ {"PacketLifeTime", "infiniband.multipathrecord.packetlifetime", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_IndependenceSelector,
+ {"IndependenceSelector", "infiniband.multipathrecord.independenceselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_GIDScope,
+ {"GIDScope", "infiniband.multipathrecord.gidscope", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_SGIDCount,
+ {"SGIDCount", "infiniband.multipathrecord.sgidcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_DGIDCount,
+ {"DGIDCount", "infiniband.multipathrecord.dgidcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_MultiPathRecord_SDGID,
+ {"SDGID", "infiniband.multipathrecord.sdgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* Notice */
+ {&hf_infiniband_Notice_IsGeneric,
+ {"IsGeneric", "infiniband.notice.isgeneric", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_Type,
+ {"Type", "infiniband.notice.type", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_ProducerTypeVendorID,
+ {"ProducerTypeVendorID", "infiniband.notice.producertypevendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_TrapNumberDeviceID,
+ {"TrapNumberDeviceID", "infiniband.notice.trapnumberdeviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_IssuerLID,
+ {"IssuerLID", "infiniband.notice.issuerlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_NoticeToggle,
+ {"NoticeToggle", "infiniband.notice.noticetoggle", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_NoticeCount,
+ {"NoticeCount", "infiniband.notice.noticecount", FT_UINT16, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_DataDetails,
+ {"DataDetails", "infiniband.notice.datadetails", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_IssuerGID,
+ {"IssuerGID", "infiniband.notice.issuergid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_Notice_ClassTrapSpecificData,
+ {"ClassTrapSpecificData", "infiniband.notice.classtrapspecificdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* Traps 64,65,66,67 */
+ {&hf_infiniband_Trap_GIDADDR,
+ {"GIDADDR", "infiniband.trap.gidaddr", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* Traps 68,69 */
+ {&hf_infiniband_Trap_COMP_MASK,
+ {"COMP_MASK", "infiniband.trap.comp_mask", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_WAIT_FOR_REPATH,
+ {"WAIT_FOR_REPATH", "infiniband.trap.wait_for_repath", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_PATH_REC,
+ {"PATH_REC", "infiniband.trap.path_rec", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* Trap 128 */
+ {&hf_infiniband_Trap_LIDADDR,
+ {"LIDADDR", "infiniband.trap.lidaddr", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* Trap 129, 130, 131 */
+ {&hf_infiniband_Trap_PORTNO,
+ {"PORTNO", "infiniband.trap.portno", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ /* Trap 144 */
+ {&hf_infiniband_Trap_OtherLocalChanges,
+ {"OtherLocalChanges", "infiniband.trap.otherlocalchanges", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_CAPABILITYMASK,
+ {"CAPABILITYMASK", "infiniband.trap.capabilitymask", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_LinkSpeecEnabledChange,
+ {"LinkSpeecEnabledChange", "infiniband.trap.linkspeecenabledchange", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_LinkWidthEnabledChange,
+ {"LinkWidthEnabledChange", "infiniband.trap.linkwidthenabledchange", FT_UINT8, BASE_HEX, NULL, 0x02, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_NodeDescriptionChange,
+ {"NodeDescriptionChange", "infiniband.trap.nodedescriptionchange", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ /* Trap 145 */
+ {&hf_infiniband_Trap_SYSTEMIMAGEGUID,
+ {"SYSTEMIMAGEGUID", "infiniband.trap.systemimageguid", FT_UINT64, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ /* Trap 256 */
+ {&hf_infiniband_Trap_DRSLID,
+ {"DRSLID", "infiniband.trap.drslid", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_METHOD,
+ {"METHOD", "infiniband.trap.method", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_ATTRIBUTEID,
+ {"ATTRIBUTEID", "infiniband.trap.attributeid", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_ATTRIBUTEMODIFIER,
+ {"ATTRIBUTEMODIFIER", "infiniband.trap.attributemodifier", FT_UINT32, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_MKEY,
+ {"MKEY", "infiniband.trap.mkey", FT_UINT64, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_DRNotice,
+ {"DRNotice", "infiniband.trap.drnotice", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_DRPathTruncated,
+ {"DRPathTruncated", "infiniband.trap.drpathtruncated", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_DRHopCount,
+ {"DRHopCount", "infiniband.trap.drhopcount", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_DRNoticeReturnPath,
+ {"DRNoticeReturnPath", "infiniband.trap.drnoticereturnpath", FT_BYTES, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ /* Trap 257, 258 */
+ {&hf_infiniband_Trap_LIDADDR1,
+ {"LIDADDR1", "infiniband.trap.lidaddr1", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_LIDADDR2,
+ {"LIDADDR2", "infiniband.trap.lidaddr2", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_KEY,
+ {"KEY", "infiniband.trap.key", FT_UINT32, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_SL,
+ {"SL", "infiniband.trap.sl", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_QP1,
+ {"QP1", "infiniband.trap.qp1", FT_UINT24, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_QP2,
+ {"QP2", "infiniband.trap.qp2", FT_UINT24, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_GIDADDR1,
+ {"GIDADDR1", "infiniband.trap.gidaddr1", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_GIDADDR2,
+ {"GIDADDR2", "infiniband.trap.gidaddr2", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ /* Trap 259 */
+ {&hf_infiniband_Trap_DataValid,
+ {"DataValid", "infiniband.trap.datavalid", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_PKEY,
+ {"PKEY", "infiniband.trap.pkey", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ },
+ {&hf_infiniband_Trap_SWLIDADDR,
+ {"SWLIDADDR", "infiniband.trap.swlidaddr", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
+ }
+};
+
+/* Array to hold expansion options between dissections */
+static gint *ett[] = {
+ &ett_infiniband,
+ &ett_all_headers,
+ &ett_lrh,
+ &ett_grh,
+ &ett_bth,
+ &ett_rwh,
+ &ett_rawdata,
+ &ett_rdeth,
+ &ett_deth,
+ &ett_reth,
+ &ett_atomiceth,
+ &ett_aeth,
+ &ett_atomicacketh,
+ &ett_immdt,
+ &ett_ieth,
+ &ett_payload,
+ &ett_vendor,
+ &ett_subn_lid_routed,
+ &ett_subn_directed_route,
+ &ett_subnadmin,
+ &ett_mad,
+ &ett_rmpp,
+ &ett_subm_attribute,
+ &ett_suba_attribute,
+ &ett_datadetails,
+ &ett_noticestraps,
+ &ett_nodedesc,
+ &ett_nodeinfo,
+ &ett_switchinfo,
+ &ett_guidinfo,
+ &ett_portinfo,
+ &ett_portinfo_capmask,
+ &ett_pkeytable,
+ &ett_sltovlmapping,
+ &ett_vlarbitrationtable,
+ &ett_linearforwardingtable,
+ &ett_randomforwardingtable,
+ &ett_multicastforwardingtable,
+ &ett_sminfo,
+ &ett_vendordiag,
+ &ett_ledinfo,
+ &ett_linkspeedwidthpairs,
+ &ett_informinfo,
+ &ett_linkrecord,
+ &ett_servicerecord,
+ &ett_pathrecord,
+ &ett_mcmemberrecord,
+ &ett_tracerecord,
+ &ett_multipathrecord,
+ &ett_serviceassocrecord
+};
+
+
+#endif