aboutsummaryrefslogtreecommitdiffstats
path: root/plugins
diff options
context:
space:
mode:
authorJaap Keuter <jaap.keuter@xs4all.nl>2009-02-22 10:52:05 +0000
committerJaap Keuter <jaap.keuter@xs4all.nl>2009-02-22 10:52:05 +0000
commit9fb248f1c0c2a6b6092f1902087787e2f1c8b298 (patch)
treeb977229d5abc482c555560ce87e7e1fc26775e7e /plugins
parent03bbd18a0bfb50b3d3c3c313fa112c03fd823e75 (diff)
downloadwireshark-9fb248f1c0c2a6b6092f1902087787e2f1c8b298.tar.gz
wireshark-9fb248f1c0c2a6b6092f1902087787e2f1c8b298.tar.bz2
wireshark-9fb248f1c0c2a6b6092f1902087787e2f1c8b298.zip
Incorporate plugin dissector into build in collection.
svn path=/trunk/; revision=27502
Diffstat (limited to 'plugins')
-rw-r--r--plugins/Makefile.am1
-rw-r--r--plugins/Makefile.nmake4
-rw-r--r--plugins/infiniband/Makefile.am127
-rw-r--r--plugins/infiniband/Makefile.common35
-rw-r--r--plugins/infiniband/Makefile.nmake102
-rw-r--r--plugins/infiniband/moduleinfo.h16
-rw-r--r--plugins/infiniband/moduleinfo.nmake28
-rw-r--r--plugins/infiniband/packet-infiniband.c3150
-rw-r--r--plugins/infiniband/packet-infiniband.h2571
-rw-r--r--plugins/infiniband/plugin.rc.in34
10 files changed, 0 insertions, 6068 deletions
diff --git a/plugins/Makefile.am b/plugins/Makefile.am
index 611537d4d4..f0987277c0 100644
--- a/plugins/Makefile.am
+++ b/plugins/Makefile.am
@@ -32,7 +32,6 @@ SUBDIRS = $(_CUSTOM_SUBDIRS_) \
ethercat \
giop \
gryphon \
- infiniband \
irda \
m2m \
mate \
diff --git a/plugins/Makefile.nmake b/plugins/Makefile.nmake
index 6e13ecb416..b3cefe987a 100644
--- a/plugins/Makefile.nmake
+++ b/plugins/Makefile.nmake
@@ -57,9 +57,6 @@ process-plugins:
cd gryphon
$(MAKE) /$(MAKEFLAGS) -f Makefile.nmake $(PLUGIN_TARGET)
cd ..
- cd infiniband
- $(MAKE) /$(MAKEFLAGS) -f Makefile.nmake $(PLUGIN_TARGET)
- cd ..
cd irda
$(MAKE) /$(MAKEFLAGS) -f Makefile.nmake $(PLUGIN_TARGET)
cd ..
@@ -109,7 +106,6 @@ install-plugins:
xcopy plugins\ethercat\*.dll $(INSTALL_DIR)\plugins\$(VERSION) /d
xcopy plugins\giop\*.dll $(INSTALL_DIR)\plugins\$(VERSION) /d
xcopy plugins\gryphon\*.dll $(INSTALL_DIR)\plugins\$(VERSION) /d
- xcopy plugins\infiniband\*.dll $(INSTALL_DIR)\plugins\$(VERSION) /d
xcopy plugins\irda\*.dll $(INSTALL_DIR)\plugins\$(VERSION) /d
xcopy plugins\m2m\*.dll $(INSTALL_DIR)\plugins\$(VERSION) /d
xcopy plugins\mate\*.dll $(INSTALL_DIR)\plugins\$(VERSION) /d
diff --git a/plugins/infiniband/Makefile.am b/plugins/infiniband/Makefile.am
deleted file mode 100644
index 1fbb3a47b6..0000000000
--- a/plugins/infiniband/Makefile.am
+++ /dev/null
@@ -1,127 +0,0 @@
-# Makefile.am
-# Automake file for Infiniband plugin
-#
-# $Id$
-#
-# Wireshark - Network traffic analyzer
-# By Gerald Combs <gerald@wireshark.org>
-# Copyright 1998 Gerald Combs
-#
-# This program is free software; you can redistribute it and/or
-# modify it under the terms of the GNU General Public License
-# as published by the Free Software Foundation; either version 2
-# of the License, or (at your option) any later version.
-#
-# This program is distributed in the hope that it will be useful,
-# but WITHOUT ANY WARRANTY; without even the implied warranty of
-# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
-# GNU General Public License for more details.
-#
-# You should have received a copy of the GNU General Public License
-# along with this program; if not, write to the Free Software
-# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.
-#
-
-INCLUDES = -I$(top_srcdir) -I$(includedir)
-
-include Makefile.common
-
-if HAVE_WARNINGS_AS_ERRORS
-AM_CFLAGS = -Werror
-endif
-
-plugindir = @plugindir@
-
-plugin_LTLIBRARIES = infiniband.la
-infiniband_la_SOURCES = \
- plugin.c \
- moduleinfo.h \
- $(DISSECTOR_SRC) \
- $(DISSECTOR_INCLUDES)
-infiniband_la_LDFLAGS = -module -avoid-version
-infiniband_la_LIBADD = @PLUGIN_LIBS@
-
-# Libs must be cleared, or else libtool won't create a shared module.
-# If your module needs to be linked against any particular libraries,
-# add them here.
-LIBS =
-
-#
-# Build plugin.c, which contains the plugin version[] string, a
-# function plugin_register() that calls the register routines for all
-# protocols, and a function plugin_reg_handoff() that calls the handoff
-# registration routines for all protocols.
-#
-# We do this by scanning sources. If that turns out to be too slow,
-# maybe we could just require every .o file to have an register routine
-# of a given name (packet-aarp.o -> proto_register_aarp, etc.).
-#
-# Formatting conventions: The name of the proto_register_* routines an
-# proto_reg_handoff_* routines must start in column zero, or must be
-# preceded only by "void " starting in column zero, and must not be
-# inside #if.
-#
-# DISSECTOR_SRC is assumed to have all the files that need to be scanned.
-#
-# For some unknown reason, having a big "for" loop in the Makefile
-# to scan all the files doesn't work with some "make"s; they seem to
-# pass only the first few names in the list to the shell, for some
-# reason.
-#
-# Therefore, we have a script to generate the plugin.c file.
-# The shell script runs slowly, as multiple greps and seds are run
-# for each input file; this is especially slow on Windows. Therefore,
-# if Python is present (as indicated by PYTHON being defined), we run
-# a faster Python script to do that work instead.
-#
-# The first argument is the directory in which the source files live.
-# The second argument is "plugin", to indicate that we should build
-# a plugin.c file for a plugin.
-# All subsequent arguments are the files to scan.
-#
-plugin.c: $(DISSECTOR_SRC) $(top_srcdir)/tools/make-dissector-reg \
- $(top_srcdir)/tools/make-dissector-reg.py
- @if test -n $(PYTHON); then \
- echo Making plugin.c with python ; \
- $(PYTHON) $(top_srcdir)/tools/make-dissector-reg.py $(srcdir) \
- plugin $(DISSECTOR_SRC) ; \
- else \
- echo Making plugin.c with shell script ; \
- $(top_srcdir)/tools/make-dissector-reg $(srcdir) \
- $(plugin_src) plugin $(DISSECTOR_SRC) ; \
- fi
-
-#
-# Currently plugin.c can be included in the distribution because
-# we always build all protocol dissectors. We used to have to check
-# whether or not to build the snmp dissector. If we again need to
-# variably build something, making plugin.c non-portable, uncomment
-# the dist-hook line below.
-#
-# Oh, yuk. We don't want to include "plugin.c" in the distribution, as
-# its contents depend on the configuration, and therefore we want it
-# to be built when the first "make" is done; however, Automake insists
-# on putting *all* source into the distribution.
-#
-# We work around this by having a "dist-hook" rule that deletes
-# "plugin.c", so that "dist" won't pick it up.
-#
-#dist-hook:
-# @rm -f $(distdir)/plugin.c
-
-CLEANFILES = \
- infiniband \
- *~
-
-MAINTAINERCLEANFILES = \
- Makefile.in \
- plugin.c
-
-EXTRA_DIST = \
- Makefile.common \
- Makefile.nmake \
- moduleinfo.nmake \
- plugin.rc.in
-
-checkapi:
- $(PERL) $(top_srcdir)/tools/checkAPIs.pl -g abort -g termoutput $(DISSECTOR_SRC)
diff --git a/plugins/infiniband/Makefile.common b/plugins/infiniband/Makefile.common
deleted file mode 100644
index 147ef613b6..0000000000
--- a/plugins/infiniband/Makefile.common
+++ /dev/null
@@ -1,35 +0,0 @@
-# Makefile.common for Infiniband plugin
-# Contains the stuff from Makefile.am and Makefile.nmake that is
-# a) common to both files and
-# b) portable between both files
-#
-# $Id$
-#
-# Wireshark - Network traffic analyzer
-# By Gerald Combs <gerald@wireshark.org>
-# Copyright 1998 Gerald Combs
-#
-# This program is free software; you can redistribute it and/or
-# modify it under the terms of the GNU General Public License
-# as published by the Free Software Foundation; either version 2
-# of the License, or (at your option) any later version.
-#
-# This program is distributed in the hope that it will be useful,
-# but WITHOUT ANY WARRANTY; without even the implied warranty of
-# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
-# GNU General Public License for more details.
-#
-# You should have received a copy of the GNU General Public License
-# along with this program; if not, write to the Free Software
-# Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.
-
-# the name of the plugin
-PLUGIN_NAME = infiniband
-
-# the dissector sources (without any helpers)
-DISSECTOR_SRC = \
- packet-infiniband.c
-
-DISSECTOR_INCLUDES = \
- packet-infiniband.h
-
diff --git a/plugins/infiniband/Makefile.nmake b/plugins/infiniband/Makefile.nmake
deleted file mode 100644
index f83e2b6d7f..0000000000
--- a/plugins/infiniband/Makefile.nmake
+++ /dev/null
@@ -1,102 +0,0 @@
-# Makefile.nmake
-# nmake file for Wireshark plugin
-#
-# $Id$
-#
-
-include ..\..\config.nmake
-include moduleinfo.nmake
-
-include Makefile.common
-
-CFLAGS=/WX /DHAVE_CONFIG_H /I../.. $(GLIB_CFLAGS) \
- /I$(PCAP_DIR)\include -D_U_="" $(LOCAL_CFLAGS)
-
-LDFLAGS = $(PLUGIN_LDFLAGS)
-
-!IFDEF ENABLE_LIBWIRESHARK
-LINK_PLUGIN_WITH=..\..\epan\libwireshark.lib
-CFLAGS=/DHAVE_WIN32_LIBWIRESHARK_LIB /D_NEED_VAR_IMPORT_ $(CFLAGS)
-
-DISSECTOR_OBJECTS = $(DISSECTOR_SRC:.c=.obj)
-
-DISSECTOR_SUPPORT_OBJECTS = $(DISSECTOR_SUPPORT_SRC:.c=.obj)
-
-OBJECTS = $(DISSECTOR_OBJECTS) $(DISSECTOR_SUPPORT_OBJECTS) plugin.obj
-
-RESOURCE=$(PLUGIN_NAME).res
-
-all: $(PLUGIN_NAME).dll
-
-$(PLUGIN_NAME).rc : moduleinfo.nmake
- sed -e s/@PLUGIN_NAME@/$(PLUGIN_NAME)/ \
- -e s/@RC_MODULE_VERSION@/$(RC_MODULE_VERSION)/ \
- -e s/@RC_VERSION@/$(RC_VERSION)/ \
- -e s/@MODULE_VERSION@/$(MODULE_VERSION)/ \
- -e s/@PACKAGE@/$(PACKAGE)/ \
- -e s/@VERSION@/$(VERSION)/ \
- -e s/@MSVC_VARIANT@/$(MSVC_VARIANT)/ \
- < plugin.rc.in > $@
-
-$(PLUGIN_NAME).dll $(PLUGIN_NAME).exp $(PLUGIN_NAME).lib : $(OBJECTS) $(LINK_PLUGIN_WITH) $(RESOURCE)
- link -dll /out:$(PLUGIN_NAME).dll $(LDFLAGS) $(OBJECTS) $(LINK_PLUGIN_WITH) \
- $(GLIB_LIBS) $(RESOURCE)
-!IF $(MSC_VER_REQUIRED) >= 1400
- mt.exe -nologo -manifest "$(PLUGIN_NAME).dll.manifest" -outputresource:$(PLUGIN_NAME).dll;2
-!ENDIF
-
-#
-# Build plugin.c, which contains the plugin version[] string, a
-# function plugin_register() that calls the register routines for all
-# protocols, and a function plugin_reg_handoff() that calls the handoff
-# registration routines for all protocols.
-#
-# We do this by scanning sources. If that turns out to be too slow,
-# maybe we could just require every .o file to have an register routine
-# of a given name (packet-aarp.o -> proto_register_aarp, etc.).
-#
-# Formatting conventions: The name of the proto_register_* routines an
-# proto_reg_handoff_* routines must start in column zero, or must be
-# preceded only by "void " starting in column zero, and must not be
-# inside #if.
-#
-# DISSECTOR_SRC is assumed to have all the files that need to be scanned.
-#
-# For some unknown reason, having a big "for" loop in the Makefile
-# to scan all the files doesn't work with some "make"s; they seem to
-# pass only the first few names in the list to the shell, for some
-# reason.
-#
-# Therefore, we have a script to generate the plugin.c file.
-# The shell script runs slowly, as multiple greps and seds are run
-# for each input file; this is especially slow on Windows. Therefore,
-# if Python is present (as indicated by PYTHON being defined), we run
-# a faster Python script to do that work instead.
-#
-# The first argument is the directory in which the source files live.
-# The second argument is "plugin", to indicate that we should build
-# a plugin.c file for a plugin.
-# All subsequent arguments are the files to scan.
-#
-plugin.c: $(DISSECTOR_SRC) ../../tools/make-dissector-reg.py ../../tools/make-dissector-reg
-!IFDEF PYTHON
- @echo Making plugin.c (using python)
- @$(PYTHON) "../../tools/make-dissector-reg.py" . plugin $(DISSECTOR_SRC)
-!ELSE
- @echo Making plugin.c (using sh)
- @$(SH) ../../tools/make-dissector-reg . plugin $(DISSECTOR_SRC)
-!ENDIF
-
-!ENDIF
-
-clean:
- rm -f $(OBJECTS) $(RESOURCE) plugin.c *.pdb \
- $(PLUGIN_NAME).dll $(PLUGIN_NAME).dll.manifest $(PLUGIN_NAME).lib \
- $(PLUGIN_NAME).exp $(PLUGIN_NAME).rc
-
-distclean: clean
-
-maintainer-clean: distclean
-
-checkapi:
- $(PERL) ../../tools/checkAPIs.pl -g abort -g termoutput $(DISSECTOR_SRC)
diff --git a/plugins/infiniband/moduleinfo.h b/plugins/infiniband/moduleinfo.h
deleted file mode 100644
index 97a1fd2f75..0000000000
--- a/plugins/infiniband/moduleinfo.h
+++ /dev/null
@@ -1,16 +0,0 @@
-/* Included *after* config.h, in order to re-define these macros */
-
-#ifdef PACKAGE
-#undef PACKAGE
-#endif
-
-/* Name of package */
-#define PACKAGE "infiniband"
-
-
-#ifdef VERSION
-#undef VERSION
-#endif
-
-/* Version number of package */
-#define VERSION "1.2.0"
diff --git a/plugins/infiniband/moduleinfo.nmake b/plugins/infiniband/moduleinfo.nmake
deleted file mode 100644
index 3b514a3bde..0000000000
--- a/plugins/infiniband/moduleinfo.nmake
+++ /dev/null
@@ -1,28 +0,0 @@
-#
-# $Id$
-#
-
-# The name
-PACKAGE=infiniband
-
-# The version
-MODULE_VERSION_MAJOR=1
-MODULE_VERSION_MINOR=2
-MODULE_VERSION_MICRO=0
-MODULE_VERSION_EXTRA=0
-
-#
-# The RC_VERSION should be comma-separated, not dot-separated,
-# as per Graham Bloice's message in
-#
-# http://www.ethereal.com/lists/ethereal-dev/200303/msg00283.html
-#
-# "The RC_VERSION variable in config.nmake should be comma separated.
-# This allows the resources to be built correctly and the version
-# number to be correctly displayed in the explorer properties dialog
-# for the executables, and XP's tooltip, rather than 0.0.0.0."
-#
-
-MODULE_VERSION=$(MODULE_VERSION_MAJOR).$(MODULE_VERSION_MINOR).$(MODULE_VERSION_MICRO).$(MODULE_VERSION_EXTRA)
-RC_MODULE_VERSION=$(MODULE_VERSION_MAJOR),$(MODULE_VERSION_MINOR),$(MODULE_VERSION_MICRO),$(MODULE_VERSION_EXTRA)
-
diff --git a/plugins/infiniband/packet-infiniband.c b/plugins/infiniband/packet-infiniband.c
deleted file mode 100644
index 59db318926..0000000000
--- a/plugins/infiniband/packet-infiniband.c
+++ /dev/null
@@ -1,3150 +0,0 @@
-/* packet-infiniband.c
- * Routines for Infiniband/ERF Dissection
- *
- * $Id$
- *
- * Copyright 2008 Endace Technology Limited
- *
- * This program is free software; you can redistribute it and/or
- * modify it under the terms of the GNU General Public License
- * as published by the Free Software Foundation; either version 2
- * of the License, or (at your option) any later version.
- *
- * This program is distributed in the hope that it will be useful,
- * but WITHOUT ANY WARRANTY; without even the implied warranty of
- * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
- * GNU General Public License for more details.
- *
- * You should have received a copy of the GNU General Public License
- * along with this program; if not, write to the Free Software
- * Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.
- */
-
-#ifdef HAVE_CONFIG_H
-# include "config.h"
-#endif
-#include <stdio.h>
-#include <stdlib.h>
-#include <string.h>
-#include <glib.h>
-#include <epan/packet.h>
-#include <epan/proto.h>
-#include <epan/dissectors/packet-frame.h>
-#include "packet-infiniband.h"
-
-
-/* Protocol Registration */
-void proto_register_infiniband(void)
-{
- proto_infiniband = proto_register_protocol("InfiniBand", "InfiniBand", "infiniband");
- register_dissector("infiniband", dissect_infiniband, proto_infiniband);
-
- proto_register_field_array(proto_infiniband, hf, array_length(hf));
- proto_register_subtree_array(ett, array_length(ett));
-
-}
-
-/* Reg Handoff. Register dissectors we'll need for IPoIB */
-void proto_reg_handoff_infiniband(void)
-{
- ipv6_handle = find_dissector("ipv6");
- data_handle = find_dissector("data");
- ethertype_dissector_table = find_dissector_table("ethertype");
-}
-
-
-/* Main Dissector */
-/* Notes: */
-/* 1.) Floating "offset+=" statements should probably be "functionized" but they are inline */
-/* Offset is only passed by reference in specific places, so do not be confused when following code */
-/* In any code path, adding up "offset+=" statements will tell you what byte you are at */
-static void
-dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree)
-{
- /* Top Level Item */
- proto_item *infiniband_packet = NULL;
-
- /* The Headers Subtree */
- proto_tree *all_headers_tree = NULL;
-
- /* LRH - Local Route Header */
- proto_tree *local_route_header_tree = NULL;
- proto_item *local_route_header_item = NULL;
-
- /* GRH - Global Route Header */
- proto_tree *global_route_header_tree = NULL;
- proto_item *global_route_header_item = NULL;
-
- /* BTH - Base Transport header */
- proto_tree *base_transport_header_tree = NULL;
- proto_item *base_transport_header_item = NULL;
-
- /* Raw Data */
- proto_tree *RAWDATA_header_tree;
- proto_item *RAWDATA_header_item;
- guint8 lnh_val = 0; /* Link Next Header Value */
- gint offset = 0; /* Current Offset */
-
- /* General Variables */
- gboolean bthFollows = 0; /* Tracks if we are parsing a BTH. This is a significant decision point */
- guint8 virtualLane = 0; /* IB VirtualLane. Keyed off of for detecting subnet admin/management */
- guint8 opCode = 0; /* OpCode from BTH header. */
- gint32 nextHeaderSequence = -1; /* defined by this dissector. #define which indicates the upcoming header sequence from OpCode */
- guint16 payloadLength = 0; /* Payload Length should it exist */
- guint8 nxtHdr = 0; /* Keyed off for header dissection order */
- guint16 packetLength = 0; /* Packet Length. We track this as tvb->length - offset. It provides the parsing methods a known size */ /* that must be available for that header. */
- struct e_in6_addr SRCgid; /* Structures to hold GIDs should be need them */
- struct e_in6_addr DSTgid;
- gint crc_length = 0;
-
- /* Mark the Packet type as Infiniband in the wireshark UI */
- /* Clear other columns */
- if(pinfo->cinfo)
- {
- if(check_col(pinfo->cinfo, COL_PROTOCOL))
- col_set_str(pinfo->cinfo, COL_PROTOCOL, "InfiniBand");
- if(check_col(pinfo->cinfo, COL_INFO))
- col_clear(pinfo->cinfo, COL_INFO);
- }
-
- /* Get the parent tree from the ERF dissector. We don't want to nest under ERF */
- if(tree && tree->parent)
- {
- /* Set the normal tree outside of ERF */
- tree = tree->parent;
- /* Set a global reference for nested protocols */
- top_tree = tree;
- }
-
- if(!tree)
- {
- /* If no packet details are being dissected, extract some high level info for the packet view */
- /* Assigns column values rather than full tree population */
- dissect_general_info(tvb, offset, pinfo);
- return;
- }
-
- /* Top Level Packet */
- infiniband_packet = proto_tree_add_item(tree, proto_infiniband, tvb, offset, -1, FALSE);
-
- /* Headers Level Tree */
- all_headers_tree = proto_item_add_subtree(infiniband_packet, ett_all_headers);
-
- /* Local Route Header Subtree */
- local_route_header_item = proto_tree_add_bytes(all_headers_tree, hf_infiniband_LRH, tvb, offset, 8, tvb->real_data);
- proto_item_set_text(local_route_header_item, "%s", "Local Route Header");
- local_route_header_tree = proto_item_add_subtree(local_route_header_item, ett_lrh);
-
- proto_tree_add_item(local_route_header_tree, hf_infiniband_virtual_lane, tvb, offset, 1, FALSE);
-
-
- /* Get the Virtual Lane. We'll use this to identify Subnet Management and Subnet Administration Packets. */
- virtualLane = tvb_get_guint8(tvb, offset);
- virtualLane = virtualLane & 0xF0;
-
-
- proto_tree_add_item(local_route_header_tree, hf_infiniband_link_version, tvb, offset, 1, FALSE); offset+=1;
- proto_tree_add_item(local_route_header_tree, hf_infiniband_service_level, tvb, offset, 1, FALSE);
-
- proto_tree_add_item(local_route_header_tree, hf_infiniband_reserved2, tvb, offset, 1, FALSE);
- proto_tree_add_item(local_route_header_tree, hf_infiniband_link_next_header, tvb, offset, 1, FALSE);
-
-
- /* Save Link Next Header... This tells us what the next header is. */
- lnh_val = tvb_get_guint8(tvb, offset);
- lnh_val = lnh_val & 0x03;
- offset+=1;
-
-
- proto_tree_add_item(local_route_header_tree, hf_infiniband_destination_local_id, tvb, offset, 2, FALSE);
-
-
- /* Set destination in packet view. */
- if (check_col(pinfo->cinfo, COL_DEF_DST))
- {
- col_add_fstr(pinfo->cinfo, COL_DEF_DST, "DLID: %s", tvb_bytes_to_str(tvb, offset, 2));
- }
- offset+=2;
-
-
- proto_tree_add_item(local_route_header_tree, hf_infiniband_reserved5, tvb, offset, 2, FALSE);
-
- packetLength = tvb_get_ntohs(tvb, offset); /* Get the Packet Length. This will determine payload size later on. */
- packetLength = packetLength & 0x07FF; /* Mask off top 5 bits, they are reserved */
- packetLength = packetLength * 4; /* Multiply by 4 to get true byte length. This is by specification. PktLen is size in 4 byte words (byteSize /4). */
-
- proto_tree_add_item(local_route_header_tree, hf_infiniband_packet_length, tvb, offset, 2, FALSE); offset+=2;
- proto_tree_add_item(local_route_header_tree, hf_infiniband_source_local_id, tvb, offset, 2, FALSE);
-
- /* Set Source in packet view. */
- if (check_col(pinfo->cinfo, COL_DEF_SRC))
- {
- col_add_fstr(pinfo->cinfo, COL_DEF_SRC, "SLID: %s", tvb_bytes_to_str(tvb, offset, 2));
- }
-
- offset+=2;
- packetLength -= 8; /* Shave 8 bytes for the LRH. */
-
- /* Key off Link Next Header. This tells us what High Level Data Format we have */
- switch(lnh_val)
- {
- case IBA_GLOBAL:
- global_route_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_GRH, tvb, offset, 40, FALSE);
- proto_item_set_text(global_route_header_item, "%s", "Global Route Header");
- global_route_header_tree = proto_item_add_subtree(global_route_header_item, ett_grh);
-
- proto_tree_add_item(global_route_header_tree, hf_infiniband_ip_version, tvb, offset, 1, FALSE);
- proto_tree_add_item(global_route_header_tree, hf_infiniband_traffic_class, tvb, offset, 2, FALSE);
- proto_tree_add_item(global_route_header_tree, hf_infiniband_flow_label, tvb, offset, 4, FALSE); offset += 4;
-
- payloadLength = tvb_get_ntohs(tvb, offset);
-
- proto_tree_add_item(global_route_header_tree, hf_infiniband_payload_length, tvb, offset, 2, FALSE); offset += 2;
-
- nxtHdr = tvb_get_guint8(tvb, offset);
-
- proto_tree_add_item(global_route_header_tree, hf_infiniband_next_header, tvb, offset, 1, FALSE); offset +=1;
- proto_tree_add_item(global_route_header_tree, hf_infiniband_hop_limit, tvb, offset, 1, FALSE); offset +=1;
- proto_tree_add_item(global_route_header_tree, hf_infiniband_source_gid, tvb, offset, 16, FALSE);
-
- tvb_get_ipv6(tvb, offset, &SRCgid);
- if (check_col(pinfo->cinfo, COL_DEF_SRC))
- {
- col_add_fstr(pinfo->cinfo, COL_DEF_SRC, "SGID: %s", ip6_to_str(&SRCgid));
- }
- offset += 16;
-
- proto_tree_add_item(global_route_header_tree, hf_infiniband_destination_gid, tvb, offset, 16, FALSE);
-
- tvb_get_ipv6(tvb, offset, &DSTgid);
- if (check_col(pinfo->cinfo, COL_DEF_DST))
- {
- col_add_fstr(pinfo->cinfo, COL_DEF_DST, "DGID: %s", ip6_to_str(&DSTgid));
- }
- offset += 16;
- packetLength -= 40; /* Shave 40 bytes for GRH */
-
- if(nxtHdr != 0x1B)
- {
- /* Some kind of packet being transported globally with IBA, but locally it is not IBA - no BTH following. */
- break;
- }
- /* otherwise fall through and start parsing BTH */
- case IBA_LOCAL:
- bthFollows = TRUE;
- base_transport_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_BTH, tvb, offset, 12, FALSE);
- proto_item_set_text(base_transport_header_item, "%s", "Base Transport Header");
- base_transport_header_tree = proto_item_add_subtree(base_transport_header_item, ett_bth);
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_opcode, tvb, offset, 1, FALSE);
-
- /* Get the OpCode - this tells us what headers are following */
- opCode = tvb_get_guint8(tvb, offset);
- if (check_col(pinfo->cinfo, COL_INFO))
- {
- col_append_str(pinfo->cinfo, COL_INFO, val_to_str((guint32)opCode, OpCodeMap, "Unknown OpCode"));
- }
- offset +=1;
-
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_solicited_event, tvb, offset, 1, FALSE);
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_migreq, tvb, offset, 1, FALSE);
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_pad_count, tvb, offset, 1, FALSE);
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_transport_header_version, tvb, offset, 1, FALSE); offset +=1;
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_partition_key, tvb, offset, 2, FALSE); offset +=2;
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_reserved8, tvb, offset, 1, FALSE); offset +=1;
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_destination_qp, tvb, offset, 3, FALSE); offset +=3;
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_acknowledge_request, tvb, offset, 1, FALSE);
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_reserved7, tvb, offset, 1, FALSE); offset +=1;
- proto_tree_add_item(base_transport_header_tree, hf_infiniband_packet_sequence_number, tvb, offset, 3, FALSE); offset +=3;
-
-
- packetLength -= 12; /* Shave 12 for Base Transport Header */
-
- break;
- case IP_NON_IBA:
- /* Raw IPv6 Packet */
- if (check_col(pinfo->cinfo, COL_DEF_DST))
- {
- col_set_str(pinfo->cinfo, COL_DEF_DST, "IPv6 over IB Packet");
- col_set_fence(pinfo->cinfo, COL_DEF_DST);
- }
- parse_IPvSix(all_headers_tree, tvb, &offset, pinfo);
- break;
- case RAW:
- parse_RWH(all_headers_tree, tvb, &offset, pinfo);
- break;
- default:
- /* Unknown Packet */
- RAWDATA_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_raw_data, tvb, offset, -1, FALSE);
- proto_item_set_text(RAWDATA_header_item, "%s", "Unknown Raw Data - IB Encapsulated");
- RAWDATA_header_tree = proto_item_add_subtree(RAWDATA_header_item, ett_rawdata);
- break;
- }
-
- /* Base Transport header is hit quite often, however it is alone since it is the exception not the rule */
- /* Only IBA Local packets use it */
- if(bthFollows)
- {
- /* Find our next header sequence based on the Opcode
- * Each case decrements the packetLength by the amount of bytes consumed by each header.
- * The find_next_header_sequence method could be used to automate this.
- * We need to keep track of this so we know much data to mark as payload/ICRC/VCRC values. */
-
- nextHeaderSequence = find_next_header_sequence((guint32) opCode);
-
- /* find_next_header_sequence gives us the DEFINE value corresponding to the header order following */
- /* Enumerations are named intuitively, e.g. RDETH DETH PAYLOAD means there is an RDETH Header, DETH Header, and a packet payload */
- switch(nextHeaderSequence)
- {
- case RDETH_DETH_PAYLD:
- parse_RDETH(all_headers_tree, tvb, &offset);
- parse_DETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* RDETH */
- packetLength -= 8; /* DETH */
-
- parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
- break;
- case RDETH_DETH_RETH_PAYLD:
- parse_RDETH(all_headers_tree, tvb, &offset);
- parse_DETH(all_headers_tree, tvb, &offset);
- parse_RETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* RDETH */
- packetLength -= 8; /* DETH */
- packetLength -= 16; /* RETH */
-
- parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
- break;
- case RDETH_DETH_IMMDT_PAYLD:
- parse_RDETH(all_headers_tree, tvb, &offset);
- parse_DETH(all_headers_tree, tvb, &offset);
- parse_IMMDT(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* RDETH */
- packetLength -= 8; /* DETH */
- packetLength -= 4; /* IMMDT */
-
- parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
- break;
- case RDETH_DETH_RETH_IMMDT_PAYLD:
- parse_RDETH(all_headers_tree, tvb, &offset);
- parse_DETH(all_headers_tree, tvb, &offset);
- parse_RETH(all_headers_tree, tvb, &offset);
- parse_IMMDT(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* RDETH */
- packetLength -= 8; /* DETH */
- packetLength -= 16; /* RETH */
- packetLength -= 4; /* IMMDT */
-
- parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
- break;
- case RDETH_DETH_RETH:
- parse_RDETH(all_headers_tree, tvb, &offset);
- parse_DETH(all_headers_tree, tvb, &offset);
- parse_RETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* RDETH */
- packetLength -= 8; /* DETH */
- packetLength -= 16; /* RETH */
-
- break;
- case RDETH_AETH_PAYLD:
- parse_RDETH(all_headers_tree, tvb, &offset);
- parse_AETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* RDETH */
- packetLength -= 4; /* AETH */
-
- parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
- break;
- case RDETH_PAYLD:
- parse_RDETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* RDETH */
-
- parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
- break;
- case RDETH_AETH:
- parse_AETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* RDETH */
- packetLength -= 4; /* AETH */
-
-
- break;
- case RDETH_AETH_ATOMICACKETH:
- parse_RDETH(all_headers_tree, tvb, &offset);
- parse_AETH(all_headers_tree, tvb, &offset);
- parse_ATOMICACKETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* RDETH */
- packetLength -= 4; /* AETH */
- packetLength -= 8; /* AtomicAckETH */
-
-
- break;
- case RDETH_DETH_ATOMICETH:
- parse_RDETH(all_headers_tree, tvb, &offset);
- parse_DETH(all_headers_tree, tvb, &offset);
- parse_ATOMICETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* RDETH */
- packetLength -= 8; /* DETH */
- packetLength -= 28; /* AtomicETH */
-
- break;
- case RDETH_DETH:
- parse_RDETH(all_headers_tree, tvb, &offset);
- parse_DETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* RDETH */
- packetLength -= 8; /* DETH */
-
- break;
- case DETH_PAYLD:
- parse_DETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 8; /* DETH */
-
- parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
- break;
- case PAYLD:
-
- parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
- break;
- case IMMDT_PAYLD:
- parse_IMMDT(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* IMMDT */
-
- parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
- break;
- case RETH_PAYLD:
- parse_RETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 16; /* RETH */
-
- parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
- break;
- case RETH:
- parse_RETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 16; /* RETH */
-
- break;
- case AETH_PAYLD:
- parse_AETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* AETH */
-
- parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
- break;
- case AETH:
- parse_AETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* AETH */
-
- break;
- case AETH_ATOMICACKETH:
- parse_AETH(all_headers_tree, tvb, &offset);
- parse_ATOMICACKETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* AETH */
- packetLength -= 8; /* AtomicAckETH */
-
- break;
- case ATOMICETH:
- parse_ATOMICETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 28; /* AtomicETH */
-
- break;
- case IETH_PAYLD:
- parse_IETH(all_headers_tree, tvb, &offset);
-
- packetLength -= 4; /* IETH */
-
- parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
- break;
- case DETH_IMMDT_PAYLD:
- parse_DETH(all_headers_tree, tvb, &offset);
- parse_IMMDT(all_headers_tree, tvb, &offset);
-
- packetLength -= 8; /* DETH */
- packetLength -= 4; /* IMMDT */
-
- parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
- break;
- default:
- parse_VENDOR(all_headers_tree, tvb, &offset);
- break;
-
- }
-
- }
- /* Display the ICRC/VCRC */
- /* Doing it this way rather than in a variety of places according to the specific packet */
- /* If we've already displayed it crc_length comes out 0 */
- crc_length = tvb_reported_length_remaining(tvb, offset);
- if(crc_length == 6)
- {
- proto_tree_add_item(all_headers_tree, hf_infiniband_invariant_crc, tvb, offset, 4, FALSE); offset +=4;
- proto_tree_add_item(all_headers_tree, hf_infiniband_variant_crc, tvb, offset, 2, FALSE); offset+=2;
- }
- else if(crc_length == 4)
- {
- proto_tree_add_item(all_headers_tree, hf_infiniband_invariant_crc, tvb, offset, 4, FALSE); offset +=4;
- }
- else if(crc_length == 2)
- {
- proto_tree_add_item(all_headers_tree, hf_infiniband_variant_crc, tvb, offset, 2, FALSE); offset+=2;
- }
-
-}
-
-/* Description: Finds the header sequence that follows the Base Transport Header.
-* Somwhat inefficient (should be using a single key,value pair data structure)
-* But uses pure probablity to take a stab at better efficiency.
-* Searches largest header sequence groups first, and then finally resorts to single matches for unique header sequences
-* IN: OpCode: The OpCode from the Base Transport Header.
-* OUT: The Header Sequence enumeration. See Declarations for #defines from (0-22) */
-static gint32
-find_next_header_sequence(guint32 OpCode)
-{
- if(contains(OpCode, &opCode_PAYLD[0], (gint32)sizeof(opCode_PAYLD)))
- return PAYLD;
-
- if(contains(OpCode, &opCode_IMMDT_PAYLD[0], (gint32)sizeof(opCode_IMMDT_PAYLD)))
- return IMMDT_PAYLD;
-
- if(contains(OpCode, &opCode_RDETH_DETH_PAYLD[0], (gint32)sizeof(opCode_RDETH_DETH_PAYLD)))
- return RDETH_DETH_PAYLD;
-
- if(contains(OpCode, &opCode_RETH_PAYLD[0], (gint32)sizeof(opCode_RETH_PAYLD)))
- return RETH_PAYLD;
-
- if(contains(OpCode, &opCode_RDETH_AETH_PAYLD[0], (gint32)sizeof(opCode_RDETH_AETH_PAYLD)))
- return RDETH_AETH_PAYLD;
-
- if(contains(OpCode, &opCode_AETH_PAYLD[0], (gint32)sizeof(opCode_AETH_PAYLD)))
- return AETH_PAYLD;
-
- if(contains(OpCode, &opCode_RDETH_DETH_IMMDT_PAYLD[0], (gint32)sizeof(opCode_RDETH_DETH_IMMDT_PAYLD)))
- return RDETH_DETH_IMMDT_PAYLD;
-
- if(contains(OpCode, &opCode_RETH_IMMDT_PAYLD[0], (gint32)sizeof(opCode_RETH_IMMDT_PAYLD)))
- return RETH_IMMDT_PAYLD;
-
- if(contains(OpCode, &opCode_RDETH_DETH_RETH_PAYLD[0], (gint32)sizeof(opCode_RDETH_DETH_RETH_PAYLD)))
- return RDETH_DETH_RETH_PAYLD;
-
- if(contains(OpCode, &opCode_ATOMICETH[0], (gint32)sizeof(opCode_ATOMICETH)))
- return ATOMICETH;
-
- if(contains(OpCode, &opCode_IETH_PAYLD[0], (gint32)sizeof(opCode_IETH_PAYLD)))
- return IETH_PAYLD;
-
- if(contains(OpCode, &opCode_RDETH_DETH_ATOMICETH[0], (gint32)sizeof(opCode_RDETH_DETH_ATOMICETH)))
- return RDETH_DETH_ATOMICETH;
-
- if((OpCode ^ RC_ACKNOWLEDGE) == 0)
- return AETH;
-
- if((OpCode ^ RC_RDMA_READ_REQUEST) == 0)
- return RETH;
-
- if((OpCode ^ RC_ATOMIC_ACKNOWLEDGE) == 0)
- return AETH_ATOMICACKETH;
-
- if((OpCode ^ RD_RDMA_READ_RESPONSE_MIDDLE) == 0)
- return RDETH_PAYLD;
-
- if((OpCode ^ RD_ACKNOWLEDGE) == 0)
- return RDETH_AETH;
-
- if((OpCode ^ RD_ATOMIC_ACKNOWLEDGE) == 0)
- return RDETH_AETH_ATOMICACKETH;
-
- if((OpCode ^ RD_RDMA_WRITE_ONLY_IMM) == 0)
- return RDETH_DETH_RETH_IMMDT_PAYLD;
-
- if((OpCode ^ RD_RDMA_READ_REQUEST) == 0)
- return RDETH_DETH_RETH;
-
- if((OpCode ^ RD_RESYNC) == 0)
- return RDETH_DETH;
-
- if((OpCode ^ UD_SEND_ONLY) == 0)
- return DETH_PAYLD;
-
- if((OpCode ^ UD_SEND_ONLY_IMM) == 0)
- return DETH_IMMDT_PAYLD;
-
- return -1;
-}
-
-/* Description: Finds if a given value is present in an array. This is probably in a standard library somewhere,
-* But I'd rather define my own.
-* IN: OpCode: The OpCode you are looking for
-* IN: Codes: The organized array of OpCodes to look through
-* IN: Array length, because we're in C++...
-* OUT: Boolean indicating if that OpCode was found in OpCodes */
-static gboolean
-contains(guint32 OpCode, guint32* Codes, gint32 length)
-{
- gint32 i;
- for(i = 0; i < length; i++)
- {
- if((OpCode ^ Codes[i]) == 0)
- return TRUE;
- }
- return FALSE;
-}
-
-/* Parse RDETH - Reliable Datagram Extended Transport Header
-* IN: parentTree to add the dissection to - in this code the all_headers_tree
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void
-parse_RDETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
-{
- gint local_offset = *offset;
- /* RDETH - Reliable Datagram Extended Transport Header */
- proto_tree *RDETH_header_tree = NULL;
- proto_item *RDETH_header_item = NULL;
-
- RDETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_RDETH, tvb, local_offset, 4, FALSE);
- proto_item_set_text(RDETH_header_item, "%s", "RDETH - Reliable Datagram Extended Transport Header");
- RDETH_header_tree = proto_item_add_subtree(RDETH_header_item, ett_rdeth);
-
- proto_tree_add_item(RDETH_header_tree, hf_infiniband_reserved8_RDETH, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(RDETH_header_tree, hf_infiniband_ee_context, tvb, local_offset, 3, FALSE); local_offset+=3;
- *offset = local_offset;
-}
-
-/* Parse DETH - Datagram Extended Transport Header
-* IN: parentTree to add the dissection to - in this code the all_headers_tree
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void
-parse_DETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
-{
- gint local_offset = *offset;
- /* DETH - Datagram Extended Transport Header */
- proto_tree *DETH_header_tree = NULL;
- proto_item *DETH_header_item = NULL;
-
- DETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_DETH, tvb, local_offset, 8, FALSE);
- proto_item_set_text(DETH_header_item, "%s", "DETH - Datagram Extended Transport Header");
- DETH_header_tree = proto_item_add_subtree(DETH_header_item, ett_deth);
-
- proto_tree_add_item(DETH_header_tree, hf_infiniband_queue_key, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(DETH_header_tree, hf_infiniband_reserved8_DETH, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(DETH_header_tree, hf_infiniband_source_qp, tvb, local_offset, 3, FALSE); local_offset+=3;
-
- *offset = local_offset;
-}
-
-/* Parse RETH - RDMA Extended Transport Header
-* IN: parentTree to add the dissection to - in this code the all_headers_tree
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void
-parse_RETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
-{
- gint local_offset = *offset;
- /* RETH - RDMA Extended Transport Header */
- proto_tree *RETH_header_tree = NULL;
- proto_item *RETH_header_item = NULL;
-
- RETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_RETH, tvb, local_offset, 16, FALSE);
- proto_item_set_text(RETH_header_item, "%s", "RETH - RDMA Extended Transport Header");
- RETH_header_tree = proto_item_add_subtree(RETH_header_item, ett_reth);
-
- proto_tree_add_item(RETH_header_tree, hf_infiniband_virtual_address, tvb, local_offset, 8, FALSE); local_offset+=8;
- proto_tree_add_item(RETH_header_tree, hf_infiniband_remote_key, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(RETH_header_tree, hf_infiniband_dma_length, tvb, local_offset, 4, FALSE); local_offset+=4;
-
- *offset = local_offset;
-}
-
-/* Parse AtomicETH - Atomic Extended Transport Header
-* IN: parentTree to add the dissection to - in this code the all_headers_tree
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void
-parse_ATOMICETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
-{
- gint local_offset = *offset;
- /* AtomicETH - Atomic Extended Transport Header */
- proto_tree *ATOMICETH_header_tree = NULL;
- proto_item *ATOMICETH_header_item = NULL;
-
- ATOMICETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_AtomicETH, tvb, local_offset, 28, FALSE);
- proto_item_set_text(ATOMICETH_header_item, "%s", "AtomicETH - Atomic Extended Transport Header");
- ATOMICETH_header_tree = proto_item_add_subtree(ATOMICETH_header_item, ett_atomiceth);
-
- proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_virtual_address, tvb, local_offset, 8, FALSE); local_offset+=8;
- proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_remote_key, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_swap_or_add_data, tvb, local_offset, 8, FALSE); local_offset+=8;
- proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_compare_data, tvb, local_offset, 8, FALSE); local_offset+=8;
- *offset = local_offset;
-}
-
-/* Parse AETH - ACK Extended Transport Header
-* IN: parentTree to add the dissection to - in this code the all_headers_tree
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void
-parse_AETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
-{
- gint local_offset = *offset;
- /* AETH - ACK Extended Transport Header */
- proto_tree *AETH_header_tree = NULL;
- proto_item *AETH_header_item = NULL;
-
- AETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_AETH, tvb, local_offset, 4, FALSE);
- proto_item_set_text(AETH_header_item, "%s", "AETH - ACK Extended Transport Header");
- AETH_header_tree = proto_item_add_subtree(AETH_header_item, ett_aeth);
-
- proto_tree_add_item(AETH_header_tree, hf_infiniband_syndrome, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(AETH_header_tree, hf_infiniband_message_sequence_number, tvb, local_offset, 3, FALSE); local_offset+=3;
-
- *offset = local_offset;
-}
-
-/* Parse AtomicAckEth - Atomic ACK Extended Transport Header
-* IN: parentTree to add the dissection to - in this code the all_headers_tree
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void
-parse_ATOMICACKETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
-{
- gint local_offset = *offset;
- /* AtomicAckEth - Atomic ACK Extended Transport Header */
- proto_tree *ATOMICACKETH_header_tree = NULL;
- proto_item *ATOMICACKETH_header_item = NULL;
-
- ATOMICACKETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_AtomicAckETH, tvb, local_offset, 8, FALSE);
- proto_item_set_text(ATOMICACKETH_header_item, "%s", "ATOMICACKETH - Atomic ACK Extended Transport Header");
- ATOMICACKETH_header_tree = proto_item_add_subtree(ATOMICACKETH_header_item, ett_atomicacketh);
- proto_tree_add_item(ATOMICACKETH_header_tree, hf_infiniband_original_remote_data, tvb, local_offset, 8, FALSE); local_offset+=8;
- *offset = local_offset;
-}
-
-/* Parse IMMDT - Immediate Data Extended Transport Header
-* IN: parentTree to add the dissection to - in this code the all_headers_tree
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void
-parse_IMMDT(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
-{
- gint local_offset = *offset;
- /* IMMDT - Immediate Data Extended Transport Header */
- proto_tree *IMMDT_header_tree = NULL;
- proto_item *IMMDT_header_item = NULL;
-
- IMMDT_header_item = proto_tree_add_item(parentTree, hf_infiniband_IMMDT, tvb, local_offset, 4, FALSE);
- proto_item_set_text(IMMDT_header_item, "%s", "IMMDT - Immediate Data Extended Transport Header");
- IMMDT_header_tree = proto_item_add_subtree(IMMDT_header_item, ett_immdt);
- proto_tree_add_item(IMMDT_header_tree, hf_infiniband_IMMDT, tvb, local_offset, 4, FALSE); local_offset+=4;
- *offset = local_offset;
-}
-
-/* Parse IETH - Invalidate Extended Transport Header
-* IN: parentTree to add the dissection to - in this code the all_headers_tree
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void
-parse_IETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
-{
- gint local_offset = *offset;
- /* IETH - Invalidate Extended Transport Header */
- proto_tree *IETH_header_tree = NULL;
- proto_item *IETH_header_item = NULL;
-
- IETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_IETH, tvb, local_offset, 4, FALSE);
- proto_item_set_text(IETH_header_item, "%s", "IETH - Invalidate Extended Transport Header");
- IETH_header_tree = proto_item_add_subtree(IETH_header_item, ett_ieth);
-
- proto_tree_add_item(IETH_header_tree, hf_infiniband_IETH, tvb, local_offset, 4, FALSE); local_offset+=4;
-
- *offset = local_offset;
-}
-
-/* Parse Payload - Packet Payload / Invariant CRC / Variant CRC
-* IN: parentTree to add the dissection to - in this code the all_headers_tree
-* IN: pinfo - packet info from wireshark
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset
-* IN: Length of Payload */
-static void parse_PAYLOAD(proto_tree *parentTree, packet_info *pinfo, tvbuff_t *tvb, gint *offset, gint length, guint8 virtualLane)
-{
- gint local_offset = *offset;
- /* Payload - Packet Payload */
- proto_tree *PAYLOAD_header_tree = NULL;
- proto_item *PAYLOAD_header_item = NULL;
- guint8 management_class;
- tvbuff_t *volatile next_tvb;
- gint captured_length, reported_length;
- guint16 etype, reserved;
- const char *saved_proto;
- volatile gboolean dissector_found = FALSE;
-
- if(!tvb_bytes_exist(tvb, *offset, length)) /* previously consumed bytes + offset was all the data - none or corrupt payload */
- {
- if (check_col(pinfo->cinfo, COL_INFO))
- {
- col_set_str(pinfo->cinfo, COL_INFO, "Invalid Packet Length from LRH! [Malformed Packet]");
- col_set_fence(pinfo->cinfo, COL_INFO);
- }
- return;
- }
- if(virtualLane == 0xF0)
- {
- management_class = tvb_get_guint8(tvb, (*offset) + 1);
-
- if(((management_class >= (guint8)VENDOR_1_START) && (management_class <= (guint8)VENDOR_1_END))
- || ((management_class >= (guint8)VENDOR_2_START) && (management_class <= (guint8)VENDOR_2_END)))
- {
- /* parse vendor specific */
- parse_VENDOR_MANAGEMENT(parentTree, tvb, offset);
- }
- else if((management_class >= (guint8)APPLICATION_START) && (management_class <= (guint8)APPLICATION_END))
- {
- /* parse application specific */
- parse_APPLICATION_MANAGEMENT(parentTree, tvb, offset);
- }
- else if(((management_class == (guint8)0x00) || (management_class == (guint8)0x02))
- || ((management_class >= (guint8)0x50) && (management_class <= (guint8)0x80))
- || ((management_class >= (guint8)0x82)))
- {
- /* parse reserved classes */
- parse_RESERVED_MANAGEMENT(parentTree, tvb, offset);
- }
- else /* we have a normal management_class */
- {
- switch(management_class)
- {
- case SUBN_LID_ROUTED:
- /* parse subn man lid routed */
- parse_SUBN_LID_ROUTED(parentTree, pinfo, tvb, &local_offset);
- break;
- case SUBN_DIRECTED_ROUTE:
- /* parse subn directed route */
- parse_SUBN_DIRECTED_ROUTE(parentTree, pinfo, tvb, &local_offset);
- break;
- case SUBNADMN:
- /* parse sub admin */
- parse_SUBNADMN(parentTree, pinfo, tvb, &local_offset);
- break;
- case PERF:
- /* parse performance */
- parse_PERF(parentTree, tvb, &local_offset);
- break;
- case BM:
- /* parse baseboard mgmt */
- parse_BM(parentTree, tvb, &local_offset);
- break;
- case DEV_MGT:
- /* parse device management */
- parse_DEV_MGT(parentTree, tvb, &local_offset);
- break;
- case COM_MGT:
- /* parse communication management */
- parse_COM_MGT(parentTree, tvb, &local_offset);
- break;
- case SNMP:
- /* parse snmp tunneling */
- parse_SNMP(parentTree, tvb, &local_offset);
- break;
- default:
- break;
- }
- }
- }
- else /* Normal Data Packet - Parse as such */
- {
-
- /* Calculation for Payload:
- * (tvb->length) Length of entire packet - (local_offset) Starting byte of Payload Data
- * offset addition is more complex for the payload.
- * We need the total length of the packet, - length of previous headers, + offset where payload started.
- * We also need to reserve 6 bytes for the CRCs which are not actually part of the payload. */
-
- /* IBA packet data could be anything in principle, however it is common
- * practice to carry non-IBA data encapsulated with an EtherType header,
- * similar to the RWH header. There is no way to identify these frames
- * positively.
- *
- * We see if the first few bytes look like an EtherType header, and if so
- * call the appropriate dissector. If not we call the "data" dissector.
- */
-
- etype = tvb_get_ntohs(tvb, local_offset);
- reserved = tvb_get_ntohs(tvb, local_offset + 2);
-
- if (reserved == 0) {
-
- /* Get the captured length and reported length of the data
- after the Ethernet type. */
- captured_length = tvb_length_remaining(tvb, local_offset+4);
- reported_length = tvb_reported_length_remaining(tvb,
- local_offset+4);
-
- next_tvb = tvb_new_subset(tvb, local_offset+4, captured_length,
- reported_length);
-
- pinfo->ethertype = etype;
-
- /* Look for sub-dissector, and call it if found.
- Catch exceptions, so that if the reported length of "next_tvb"
- was reduced by some dissector before an exception was thrown,
- we can still put in an item for the trailer. */
- saved_proto = pinfo->current_proto;
- TRY {
- dissector_found = dissector_try_port(ethertype_dissector_table,
- etype, next_tvb, pinfo, top_tree);
- }
- CATCH(BoundsError) {
- /* Somebody threw BoundsError, which means that:
-
- 1) a dissector was found, so we don't need to
- dissect the payload as data or update the
- protocol or info columns;
-
- 2) dissecting the payload found that the packet was
- cut off by a snapshot length before the end of
- the payload. The trailer comes after the payload,
- so *all* of the trailer is cut off, and we'll
- just get another BoundsError if we add the trailer.
-
- Therefore, we just rethrow the exception so it gets
- reported; we don't dissect the trailer or do anything
- else. */
- RETHROW;
- }
- CATCH(OutOfMemoryError) {
- RETHROW;
- }
- CATCH_ALL {
- /* Somebody threw an exception other than BoundsError, which
- means that a dissector was found, so we don't need to
- dissect the payload as data or update the protocol or info
- columns. We just show the exception and then drive on
- to show the trailer, after noting that a dissector was
- found and restoring the protocol value that was in effect
- before we called the subdissector. */
- show_exception(next_tvb, pinfo, top_tree, EXCEPT_CODE, GET_MESSAGE);
- dissector_found = TRUE;
- pinfo->current_proto = saved_proto;
- }
- ENDTRY;
-
- if (dissector_found) {
- /* now create payload entry to show Ethertype */
- PAYLOAD_header_item = proto_tree_add_item(parentTree, hf_infiniband_payload, tvb, local_offset, tvb_reported_length_remaining(tvb, local_offset)-6, FALSE);
- proto_item_set_text(PAYLOAD_header_item, "%s", "IBA Payload - appears to be EtherType encapsulated");
- PAYLOAD_header_tree = proto_item_add_subtree(PAYLOAD_header_item, ett_payload);
- proto_tree_add_uint(PAYLOAD_header_tree, hf_infiniband_etype, tvb,
- local_offset, 2, tvb_get_ntohs(tvb, local_offset));
-
- local_offset += 2;
-
- proto_tree_add_uint(PAYLOAD_header_tree, hf_infiniband_reserved16_RWH, tvb,
- local_offset, 2, tvb_get_ntohs(tvb, local_offset));
-
-
- } else {
- tvb_free(next_tvb);
- }
-
- }
-
- if (!dissector_found) {
- /* No sub-dissector found.
- Label rest of packet as "Data" */
-
- captured_length = tvb_length_remaining(tvb, local_offset);
- reported_length = tvb_reported_length_remaining(tvb,
- local_offset);
-
- if (reported_length >= 6)
- reported_length -= 6;
- if (captured_length > reported_length)
- captured_length = reported_length;
-
- next_tvb = tvb_new_subset(tvb, local_offset,
- captured_length,
- reported_length);
-
- call_dissector(data_handle, next_tvb, pinfo, top_tree);
-
- }
-
-
- /*parse_RWH(parentTree, tvb, &local_offset, pinfo);*/
-
- /* Will contain ICRC and VCRC = 4+2 */
- local_offset = tvb_reported_length(tvb) - 6;
- }
-
- *offset = local_offset;
-}
-
-/* Parse VENDOR - Parse a vendor specific or unknown header sequence
-* IN: parentTree to add the dissection to - in this code the all_headers_tree
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void parse_VENDOR(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *VENDOR_header_tree = NULL;
- proto_item *VENDOR_header_item = NULL;
-
- VENDOR_header_item = proto_tree_add_item(parentTree, hf_infiniband_vendor, tvb, local_offset, 4, FALSE);
- proto_item_set_text(VENDOR_header_item, "%s", "Vendor Specific or Unknown Header Sequence");
- VENDOR_header_tree = proto_item_add_subtree(VENDOR_header_item, ett_vendor);
- proto_tree_add_item(VENDOR_header_tree, hf_infiniband_vendor, tvb, local_offset, -1, FALSE);
- *offset = local_offset;
-}
-
-/* Parse IPv6 - Parse an IPv6 Packet
-* IN: parentTree to add the dissection to - in this code the all_headers_tree
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset
-* IN: pinfo - packet info from wireshark */
-static void parse_IPvSix(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, packet_info *pinfo)
-{
- tvbuff_t *ipv6_tvb;
-
- /* (- 2) for VCRC which lives at the end of the packet */
- ipv6_tvb = tvb_new_subset(tvb, *offset,
- tvb_length_remaining(tvb, *offset) - 2,
- tvb_reported_length_remaining(tvb, *offset) - 2);
- call_dissector(ipv6_handle, ipv6_tvb, pinfo, parentTree);
- *offset = tvb_reported_length(tvb) - 2;
-
- /* Display the VCRC */
- proto_tree_add_item(parentTree, hf_infiniband_variant_crc, tvb, *offset, 2, FALSE);
-}
-
-/* Parse EtherType - Parse a generic IP packaet with an EtherType of IP or ARP
-* IN: parentTree to add the dissection to - in this code the all_headers_tree
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset
-* IN: pinfo - packet info from wireshark */
-static void parse_RWH(proto_tree *ah_tree, tvbuff_t *tvb, gint *offset, packet_info *pinfo)
-{
- guint16 ether_type;
-
- /* RWH - Raw Header */
- proto_tree *RWH_header_tree = NULL;
- proto_item *RWH_header_item = NULL;
-
- RWH_header_item = proto_tree_add_item(ah_tree, hf_infiniband_RWH, tvb, *offset, 4, FALSE);
- proto_item_set_text(RWH_header_item, "%s", "RWH - Raw Header");
- RWH_header_tree = proto_item_add_subtree(RWH_header_item, ett_rwh);
-
- ether_type = tvb_get_ntohs(tvb, *offset);
-#if 0
- ether_type = ether_type & 0x0F; /* mask off reserved bits just in case. */
-#endif
- *offset += 2;
-
- proto_tree_add_uint(RWH_header_tree, hf_infiniband_reserved16_RWH, tvb,
- *offset, 2, tvb_get_ntohs(tvb, *offset));
-
- *offset += 2;
-
- ethertype(ether_type, tvb, *offset, pinfo, top_tree, RWH_header_tree, hf_infiniband_etype, -1, 0);
-
- *offset = tvb_reported_length(tvb) - 2;
- /* Display the VCRC */
- proto_tree_add_item(ah_tree, hf_infiniband_variant_crc, tvb, *offset, 2, FALSE);
-
-}
-
-/* Parse Subnet Management (LID Routed)
-* IN: parentTree to add the dissection to
-* IN: pinfo - packet info from wireshark
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void parse_SUBN_LID_ROUTED(proto_tree *parentTree, packet_info *pinfo, tvbuff_t *tvb, gint *offset)
-{
- /* Parse the Common MAD Header */
- MAD_Data MadData;
- gint local_offset;
- proto_tree *SUBN_LID_ROUTED_header_tree = NULL;
- proto_item *SUBN_LID_ROUTED_header_item = NULL;
-
- if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
- {
- /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
- return;
- }
-
- local_offset = *offset;
-
- /* local_offset - 24 here because when we come out of parse_MAD_Common, the offset it sitting at the data section. */
- SUBN_LID_ROUTED_header_item = proto_tree_add_item(parentTree, hf_infiniband_SMP_LID, tvb, local_offset - 24, 256, FALSE);
- proto_item_set_text(SUBN_LID_ROUTED_header_item, "%s", "SMP (LID Routed) ");
- SUBN_LID_ROUTED_header_tree = proto_item_add_subtree(SUBN_LID_ROUTED_header_item, ett_subn_lid_routed);
- proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_m_key, tvb, local_offset, 8, FALSE); local_offset +=8;
- proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_reserved256, tvb, local_offset, 32, FALSE); local_offset +=32;
-
- label_SUBM_Method(SUBN_LID_ROUTED_header_item, &MadData, pinfo);
- label_SUBM_Attribute(SUBN_LID_ROUTED_header_item, &MadData, pinfo);
-
- /* Try to do the detail parse of the attribute. If there is an error, or the attribute is unknown, we'll just highlight the generic data. */
- if(!parse_SUBM_Attribute(SUBN_LID_ROUTED_header_tree, tvb, &local_offset, &MadData))
- {
- proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); local_offset +=64;
- }
-
- proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_reserved1024, tvb, local_offset, 128, FALSE); local_offset +=128;
- *offset = local_offset;
-}
-
-/* Parse Subnet Management (Directed Route)
-* IN: parentTree to add the dissection to
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void parse_SUBN_DIRECTED_ROUTE(proto_tree *parentTree, packet_info *pinfo, tvbuff_t *tvb, gint *offset)
-{
- /* Parse the Common MAD Header */
- MAD_Data MadData;
- gint local_offset;
- proto_tree *SUBN_DIRECTED_ROUTE_header_tree = NULL;
- proto_item *SUBN_DIRECTED_ROUTE_header_item = NULL;
-
- if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
- {
- /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
- return;
- }
-
- local_offset = *offset;
-
- /* local_offset - 24 here because when we come out of parse_MAD_Common, the offset it sitting at the data section.
- * We need to go backwards because this particular SMP uses the class specific portion of the Common MAD Header */
- SUBN_DIRECTED_ROUTE_header_item = proto_tree_add_item(parentTree, hf_infiniband_SMP_DIRECTED, tvb, local_offset - 24, 256, FALSE);
- proto_item_set_text(SUBN_DIRECTED_ROUTE_header_item, "%s", "SMP (Directed Route) ");
- SUBN_DIRECTED_ROUTE_header_tree = proto_item_add_subtree(SUBN_DIRECTED_ROUTE_header_item, ett_subn_directed_route);
-
- label_SUBM_Method(SUBN_DIRECTED_ROUTE_header_item, &MadData, pinfo);
- label_SUBM_Attribute(SUBN_DIRECTED_ROUTE_header_item, &MadData, pinfo);
-
- /* Place us at offset 4, the "D" Bit (Direction bit for Directed Route SMPs) */
- local_offset -= 20;
- proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_d, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_smp_status, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_hop_pointer, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_hop_count, tvb, local_offset, 1, FALSE); local_offset +=1;
- local_offset += 16; /* Skip over the rest of the Common MAD Header... It's already dissected by parse_MAD_Common */
- proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_m_key, tvb, local_offset, 8, FALSE); local_offset +=8;
- proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_dr_slid, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_dr_dlid, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_reserved28, tvb, local_offset, 28, FALSE); local_offset +=28;
-
- /* Try to do the detail parse of the attribute. If there is an error, or the attribute is unknown, we'll just highlight the generic data. */
- if(!parse_SUBM_Attribute(SUBN_DIRECTED_ROUTE_header_tree, tvb, &local_offset, &MadData))
- {
- proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); local_offset +=64;
- }
-
- proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_initial_path, tvb, local_offset, 64, FALSE); local_offset +=64;
- proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_return_path, tvb, local_offset, 64, FALSE); local_offset +=64;
- *offset = local_offset;
-}
-
-/* Parse Subnet Administration
-* IN: parentTree to add the dissection to
-* IN: pinfo - packet info from wireshark
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void parse_SUBNADMN(proto_tree *parentTree, packet_info *pinfo, tvbuff_t *tvb, gint *offset)
-{
- /* Parse the Common MAD Header */
- MAD_Data MadData;
- gint local_offset;
- proto_tree *SUBNADMN_header_tree = NULL;
- proto_item *SUBNADMN_header_item = NULL;
-
- if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
- {
- /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
- return;
- }
- if(!parse_RMPP(parentTree, tvb, offset))
- {
- /* TODO: Mark Corrupt Packet */
- return;
- }
- local_offset = *offset;
-
- SUBNADMN_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset - 36, 256, FALSE);
- proto_item_set_text(SUBNADMN_header_item, "%s", "SMA");
- SUBNADMN_header_tree = proto_item_add_subtree(SUBNADMN_header_item, ett_subnadmin);
-
- proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_sm_key, tvb, local_offset, 8, FALSE); local_offset+=8;
- proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_attribute_offset, tvb, local_offset, 2, FALSE); local_offset+=4;
- proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_reserved16, tvb, local_offset, 2, FALSE); local_offset+=4;
- proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_component_mask, tvb, local_offset, 8, FALSE); local_offset+=8;
-
- label_SUBA_Method(SUBNADMN_header_item, &MadData, pinfo);
- label_SUBA_Attribute(SUBNADMN_header_item, &MadData, pinfo);
-
- if(!parse_SUBA_Attribute(SUBNADMN_header_tree, tvb, &local_offset, &MadData))
- {
- proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_subnet_admin_data, tvb, local_offset, 200, FALSE); local_offset+=200;
- }
- *offset = local_offset;
-}
-
-/* Parse Performance Management
-* IN: parentTree to add the dissection to
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void parse_PERF(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
-{
- /* Parse the Common MAD Header */
- MAD_Data MadData;
- gint local_offset;
- proto_item *PERF_header_item = NULL;
-
- if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
- {
- /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
- return;
- }
- local_offset = *offset;
- PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
- proto_item_set_text(PERF_header_item, "%s", "PERF - Performance Management MAD (Dissector Not Implemented)");
- *offset = local_offset;
-}
-
-/* Parse Baseboard Management
-* IN: parentTree to add the dissection to
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void parse_BM(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
-{
- /* Parse the Common MAD Header */
- MAD_Data MadData;
- gint local_offset;
- proto_item *PERF_header_item = NULL;
-
- if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
- {
- /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
- return;
- }
- local_offset = *offset;
-
- PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
- proto_item_set_text(PERF_header_item, "%s", "BM - Baseboard Management MAD (Dissector Not Implemented)");
- *offset = local_offset;
-}
-
-/* Parse Device Management
-* IN: parentTree to add the dissection to
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void parse_DEV_MGT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
-{
- /* Parse the Common MAD Header */
- MAD_Data MadData;
- gint local_offset;
- proto_item *PERF_header_item = NULL;
-
- if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
- {
- /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
- return;
- }
- local_offset = *offset;
- PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
- proto_item_set_text(PERF_header_item, "%s", "DEV_MGT - Device Management MAD (Dissector Not Implemented)");
- *offset = local_offset;
-}
-
-/* Parse Communications Management
-* IN: parentTree to add the dissection to
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void parse_COM_MGT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
-{
- /* Parse the Common MAD Header */
- MAD_Data MadData;
- gint local_offset;
- proto_item *PERF_header_item = NULL;
-
- if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
- {
- /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
- return;
- }
- local_offset = *offset;
- PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
- proto_item_set_text(PERF_header_item, "%s", "COMM - Communication Management MAD (Dissector Not Implemented)");
- *offset = local_offset;
-}
-
-/* Parse SNMP Tunneling
-* IN: parentTree to add the dissection to
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void parse_SNMP(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
-{
- /* Parse the Common MAD Header */
- MAD_Data MadData;
- gint local_offset;
- proto_item *PERF_header_item = NULL;
-
- if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
- {
- /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
- return;
- }
- local_offset = *offset;
-
- PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
- proto_item_set_text(PERF_header_item, "%s", "SNMP - SNMP Tunneling MAD (Dissector Not Implemented)");
- *offset = local_offset;
-}
-
-/* Parse Vendor Specific Management Packets
-* IN: parentTree to add the dissection to
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void parse_VENDOR_MANAGEMENT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
-{
- /* Parse the Common MAD Header */
- MAD_Data MadData;
- gint local_offset;
- proto_item *PERF_header_item = NULL;
-
- if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
- {
- /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
- return;
- }
- local_offset = *offset;
-
- PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
- proto_item_set_text(PERF_header_item, "%s", "VENDOR - Vendor Specific Management MAD (Dissector Not Implemented)");
- *offset = local_offset;
-}
-
-/* Parse Application Specific Management Packets
-* IN: parentTree to add the dissection to
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void parse_APPLICATION_MANAGEMENT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
-{
- /* Parse the Common MAD Header */
- MAD_Data MadData;
- gint local_offset;
- proto_item *PERF_header_item = NULL;
-
- if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
- {
- /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
- return;
- }
- local_offset = *offset;
- PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
- proto_item_set_text(PERF_header_item, "%s", "APP - Application Specific MAD (Dissector Not Implemented)");
- *offset = local_offset;
-}
-
-/* Parse Reserved Management Packets.
-
-* This is an !ERROR CONDITION!
-* It means that the Management Class value used was defined as a reserved value for furture use.
-* This method is here since we will want to report this information directly to the UI without blowing up Wireshark.
-
-* IN: parentTree to add the dissection to
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static void parse_RESERVED_MANAGEMENT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
-{
- /* Parse the Common MAD Header */
- MAD_Data MadData;
- gint local_offset;
- proto_item *PERF_header_item = NULL;
-
- if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
- {
- /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
- return;
- }
- local_offset = *offset;
- PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
- proto_item_set_text(PERF_header_item, "%s", "RESERVED - Reserved MAD Type (Possible Device Error)");
- *offset = local_offset;
-}
-
-/* Parse the common MAD Header
-* IN: parentTree to add the dissection to
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset
-* IN/OUT: MadData - the data from the MAD header */
-static gboolean parse_MAD_Common(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, MAD_Data* MadData)
-{
- gint local_offset = *offset;
- proto_tree *MAD_header_tree = NULL;
- proto_item *MAD_header_item = NULL;
-
- if(MadData == NULL)
- return FALSE;
- if(!tvb_bytes_exist(tvb, *offset, 256))
- return FALSE;
-
- /* Get the Management Class to decide between LID Routed and Direct Route */
- MadData->managementClass = tvb_get_guint8(tvb, local_offset + 1);
- MadData->classVersion = tvb_get_guint8(tvb, local_offset + 2);
- MadData->method = tvb_get_guint8(tvb, local_offset + 3);
- MadData->status = tvb_get_guint8(tvb, local_offset + 4);
- MadData->classSpecific = tvb_get_ntohs(tvb, local_offset + 6);
- MadData->transactionID = tvb_get_ntoh64(tvb, local_offset + 8);
- MadData->attributeID = tvb_get_ntohs(tvb, local_offset + 16);
- MadData->attributeModifier = tvb_get_ntohl(tvb, local_offset + 20);
- tvb_memcpy(tvb, MadData->data, local_offset + 24, 232);
-
- /* Populate the Dissector Tree */
-
- MAD_header_item = proto_tree_add_item(parentTree, hf_infiniband_MAD, tvb, local_offset, 256, FALSE);
- proto_item_set_text(MAD_header_item, "%s", "MAD Header - Common Management Datagram");
- MAD_header_tree = proto_item_add_subtree(MAD_header_item, ett_mad);
-
- proto_tree_add_item(MAD_header_tree, hf_infiniband_base_version, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(MAD_header_tree, hf_infiniband_mgmt_class, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(MAD_header_tree, hf_infiniband_class_version, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(MAD_header_tree, hf_infiniband_method, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(MAD_header_tree, hf_infiniband_status, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(MAD_header_tree, hf_infiniband_class_specific, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(MAD_header_tree, hf_infiniband_transaction_id, tvb, local_offset, 8, FALSE); local_offset+=8;
- proto_tree_add_item(MAD_header_tree, hf_infiniband_attribute_id, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(MAD_header_tree, hf_infiniband_reserved16, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(MAD_header_tree, hf_infiniband_attribute_modifier, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(MAD_header_tree, hf_infiniband_data, tvb, local_offset, 232, FALSE); local_offset+=232;
- *offset = (local_offset - 232); /* Move the offset back to the start of the Data field - this will be where the other parsers start. */
-
- return TRUE;
-}
-
-/* Parse the RMPP (Reliable Multi-Packet Transaction Protocol
-* IN: parentTree to add the dissection to
-* IN: tvb - the data buffer from wireshark
-* IN/OUT: The current and updated offset */
-static gboolean parse_RMPP(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
-{
- gint local_offset = *offset;
- guint8 RMPP_Type = tvb_get_guint8(tvb, local_offset + 1);
- proto_tree *RMPP_header_tree = NULL;
- proto_item *RMPP_header_item = NULL;
-
- RMPP_header_item = proto_tree_add_item(parentTree, hf_infiniband_RMPP, tvb, local_offset, 12, FALSE);
- proto_item_set_text(RMPP_header_item, "%s", val_to_str(RMPP_Type, RMPP_Packet_Types, "Reserved RMPP Type! (0x%02x)"));
- RMPP_header_tree = proto_item_add_subtree(RMPP_header_item, ett_rmpp);
-
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_version, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_type, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_r_resp_time, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_flags, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_status, tvb, local_offset, 1, FALSE); local_offset+=1;
- switch(RMPP_Type)
- {
- case RMPP_ILLEGAL:
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_data1, tvb, local_offset, 32, FALSE); local_offset+=32;
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_data2, tvb, local_offset, 32, FALSE); local_offset+=32;
- break;
- case RMPP_DATA:
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_segment_number, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_payload_length32, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_transferred_data, tvb, local_offset, 220, FALSE);
- break;
- case RMPP_ACK:
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_segment_number, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_new_window_last, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_reserved220, tvb, local_offset, 220, FALSE);
- break;
- case RMPP_STOP:
- case RMPP_ABORT:
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_reserved32, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_reserved32, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(RMPP_header_tree, hf_infiniband_optional_extended_error_data, tvb, local_offset, 220, FALSE);
- break;
- default:
- break;
- }
- *offset = local_offset;
- return TRUE;
-}
-
-/* Parse the Method from the MAD Common Header.
-* Simply used to generate the identifier.
-* IN: SubMItem - the item to append the method label to.
-* IN: MadHeader - the MadData structure that contains the information from the Common MAD header.
-* IN: pinfo - packet info from wireshark. */
-static void label_SUBM_Method(proto_item *SubMItem, MAD_Data *MadHeader, packet_info *pinfo)
-{
- const char *label = val_to_str(MadHeader->method, SUBM_Methods, "(Unknown SubManagement Method!)");
-
- proto_item_append_text(SubMItem, "%s", label);
- if (check_col(pinfo->cinfo, COL_INFO))
- col_append_str(pinfo->cinfo, COL_INFO, label);
-}
-
-/* Parse the SA Method from the MAD Common Header.
-* Simply used to generate the identifier.
-* IN: SubAItem - the item to append the method label to.
-* IN: MadHeader - the MadData structure that contains the information from the Common MAD header.
-* IN: pinfo - packet info from wireshark. */
-static void label_SUBA_Method(proto_item *SubAItem, MAD_Data *MadHeader, packet_info *pinfo)
-{
- const char *label = val_to_str(MadHeader->method, SUBA_Methods, "(Unknown SubAdministration Method!)");
-
- proto_item_append_text(SubAItem, "%s", label);
- if (check_col(pinfo->cinfo, COL_INFO))
- col_append_str(pinfo->cinfo, COL_INFO, label);
-}
-
-/* Parse the Attribute from the MAD Common Header
-* Simply used to generate the identifier.
-* IN: SubMItem - the item to append the Attribute label to.
-* IN: MadHeader - the MadData structure that contains the information from the Common MAD header.
-* IN: pinfo - packet info from wireshark. */
-static void label_SUBM_Attribute(proto_item *SubMItem, MAD_Data *MadHeader, packet_info *pinfo)
-{
- const char *label = val_to_str(MadHeader->attributeID, SUBM_Attributes, "(Unknown SubManagement Attribute!)");
-
- proto_item_append_text(SubMItem, "%s", &label[11]);
- if (check_col(pinfo->cinfo, COL_INFO))
- col_append_str(pinfo->cinfo, COL_INFO, &label[11]);
-}
-
-/* Parse the SA Attribute from the MAD Common Header
-* Simply used to generate the identifier.
-* IN: SubAItem - the item to append the Attribute label to.
-* IN: MadHeader - the MadData structure that contains the information from the Common MAD header.
-* IN: pinfo - packet info from wireshark. */
-static void label_SUBA_Attribute(proto_item *SubAItem, MAD_Data *MadHeader, packet_info *pinfo)
-{
- const char *label = val_to_str(MadHeader->attributeID, SUBA_Attributes, "(Unknown SubAdministration Attribute!)");
-
- proto_item_append_text(SubAItem, "%s", &label[11]);
- if (check_col(pinfo->cinfo, COL_INFO))
- col_append_str(pinfo->cinfo, COL_INFO, &label[11]);
-}
-
-/* Parse the attribute from a Subnet Management Packet.
-* IN: Parent Tree to add the item to in the dissection tree
-* IN: tvbuff, offset - the data and where it is.
-* IN: MAD_Data the data from the Common MAD Header that provides the information we need */
-static gboolean parse_SUBM_Attribute(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, MAD_Data *MadHeader)
-{
- guint16 attributeID = MadHeader->attributeID;
- proto_tree *SUBM_Attribute_header_tree = NULL;
- proto_item *SUBM_Attribute_header_item = NULL;
-
- SUBM_Attribute_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, *offset, 64, FALSE);
- proto_item_set_text(SUBM_Attribute_header_item, "%s", val_to_str(attributeID, SUBM_Attributes, "Unknown Attribute Type! (0x%02x)"));
- SUBM_Attribute_header_tree = proto_item_add_subtree(SUBM_Attribute_header_item, ett_subm_attribute);
-
-
- switch(attributeID)
- {
- case 0x0002:
- parse_NoticesAndTraps(SUBM_Attribute_header_tree , tvb, offset);
- break;
- case 0x0010:
- parse_NodeDescription(SUBM_Attribute_header_tree , tvb, offset);
- break;
- case 0x0011:
- parse_NodeInfo(SUBM_Attribute_header_tree , tvb, offset);
- break;
- case 0x0012:
- parse_SwitchInfo(SUBM_Attribute_header_tree , tvb, offset);
- break;
- case 0x0014:
- parse_GUIDInfo(SUBM_Attribute_header_tree , tvb, offset);
- break;
- case 0x0015:
- parse_PortInfo(SUBM_Attribute_header_tree , tvb, offset);
- break;
- case 0x0016:
- parse_P_KeyTable(SUBM_Attribute_header_tree , tvb, offset);
- break;
- case 0x0017:
- parse_SLtoVLMappingTable(SUBM_Attribute_header_tree , tvb, offset);
- break;
- case 0x0018:
- parse_VLArbitrationTable(SUBM_Attribute_header_tree , tvb, offset);
- break;
- case 0x0019:
- parse_LinearForwardingTable(SUBM_Attribute_header_tree , tvb, offset);
- break;
- case 0x001A:
- parse_RandomForwardingTable(SUBM_Attribute_header_tree , tvb, offset);
- break;
- case 0x001B:
- parse_MulticastForwardingTable(SUBM_Attribute_header_tree , tvb, offset);
- break;
- case 0x001C:
- parse_SMInfo(SUBM_Attribute_header_tree , tvb, offset);
- break;
- case 0x0020:
- parse_VendorDiag(SUBM_Attribute_header_tree , tvb, offset);
- break;
- case 0x0030:
- parse_LedInfo(SUBM_Attribute_header_tree , tvb, offset);
- break;
- case 0x0031:
- parse_LinkSpeedWidthPairsTable(SUBM_Attribute_header_tree , tvb, offset);
- break;
- default:
- break;
- }
-
-
- *offset += 64;
- return TRUE;
-
-}
-/* Parse the attribute from a Subnet Administration Packet.
-* IN: Parent Tree to add the item to in the dissection tree
-* IN: tvbuff, offset - the data and where it is.
-* IN: MAD_Data the data from the Common MAD Header that provides the information we need */
-static gboolean parse_SUBA_Attribute(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, MAD_Data *MadHeader)
-{
- guint16 attributeID = MadHeader->attributeID;
- proto_tree *SUBA_Attribute_header_tree = NULL;
- proto_item *SUBA_Attribute_header_item = NULL;
-
- SUBA_Attribute_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, *offset, 200, FALSE);
- proto_item_set_text(SUBA_Attribute_header_item, "%s", val_to_str(attributeID, SUBA_Attributes, "Unknown Attribute Type! (0x%02x)"));
- SUBA_Attribute_header_tree = proto_item_add_subtree(SUBA_Attribute_header_item, ett_suba_attribute);
-
- /* Skim off the RID fields should they be present */
- parse_RID(SUBA_Attribute_header_tree, tvb, offset, MadHeader);
-
- /* Parse the rest of the attributes */
- switch(MadHeader->attributeID)
- {
- case 0x0001: /* (ClassPortInfo) */
- parse_PortInfo(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0002: /* (Notice) */
- parse_NoticesAndTraps(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0003: /* (InformInfo) */
- parse_InformInfo(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0011: /* (NodeRecord) */
- parse_NodeInfo(SUBA_Attribute_header_tree, tvb, offset);
- *offset += 40;
- parse_NodeDescription(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0012: /* (PortInfoRecord) */
- parse_PortInfo(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0013: /* (SLtoVLMappingTableRecord) */
- parse_SLtoVLMappingTable(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0014: /* (SwitchInfoRecord) */
- parse_SwitchInfo(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0015: /*(LinearForwardingTableRecord) */
- parse_LinearForwardingTable(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0016: /* (RandomForwardingTableRecord) */
- parse_RandomForwardingTable(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0017: /* (MulticastForwardingTableRecord) */
- parse_MulticastForwardingTable(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0018: /* (SMInfoRecord) */
- parse_SMInfo(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0019: /* (LinkSpeedWidthPairsTableRecord) */
- parse_LinkSpeedWidthPairsTable(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x00F3: /*(InformInfoRecord) */
- parse_InformInfo(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0020: /* (LinkRecord) */
- parse_LinkRecord(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0030: /* (GuidInforecord) */
- parse_GUIDInfo(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0031: /*(ServiceRecord) */
- parse_ServiceRecord(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0033: /* (P_KeyTableRecord) */
- parse_P_KeyTable(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0035: /* (PathRecord) */
- parse_PathRecord(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0036: /* (VLArbitrationTableRecord) */
- parse_VLArbitrationTable(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0038: /* (MCMemberRecord) */
- parse_MCMemberRecord(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x0039: /* (TraceRecord) */
- parse_TraceRecord(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x003A: /* (MultiPathRecord) */
- parse_MultiPathRecord(SUBA_Attribute_header_tree, tvb, offset);
- break;
- case 0x003B: /* (ServiceAssociationRecord) */
- parse_ServiceAssociationRecord(SUBA_Attribute_header_tree, tvb, offset);
- break;
- default: /* (Unknown SubAdministration Attribute!) */
- /* We've already labeled as unknown in item construction */
- break;
- }
-
- *offset += 200;
- return TRUE;
-}
-
-/* Subnet Management Attribute Parsing Methods.
-* Also Parsing for Attributes common to both SM/SA.
-* The Subnet Admin Parsing methods will call some of these methods when an attribute is present within an SA MAD
-*/
-
-
-/* Parse NoticeDataDetails Attribute Field
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* trapNumber - The Trap ID of the Trap Data being Dissected */
-
-static void parse_NoticeDataDetails(proto_tree* parentTree, tvbuff_t* tvb, gint *offset, guint16 trapNumber)
-{
- gint local_offset = *offset;
- proto_tree *DataDetails_header_tree = NULL;
- proto_item *DataDetails_header_item = NULL;
-
- if(!parentTree)
- return;
-
- DataDetails_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 54, FALSE);
- DataDetails_header_tree = proto_item_add_subtree(DataDetails_header_item, ett_datadetails);
-
-
- switch(trapNumber)
- {
- case 64:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 64 DataDetails");
- local_offset +=6;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, FALSE); local_offset+=16;
- break;
- case 65:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 65 DataDetails");
- local_offset +=6;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, FALSE); local_offset+=16;
- break;
- case 66:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 66 DataDetails");
- local_offset +=6;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, FALSE); local_offset+=16;
- break;
- case 67:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 67 DataDetails");
- local_offset +=6;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, FALSE); local_offset+=16;
- break;
- case 68:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 68 DataDetails");
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_COMP_MASK, tvb, local_offset, 8, FALSE); local_offset+=8;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_WAIT_FOR_REPATH, tvb, local_offset, 1, FALSE);
- break;
- case 69:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 69 DataDetails");
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_COMP_MASK, tvb, local_offset, 8, FALSE); local_offset+=8;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_WAIT_FOR_REPATH, tvb, local_offset, 1, FALSE);
- break;
- case 128:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 128 DataDetails");
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
- break;
- case 129:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 129 DataDetails");
- local_offset += 2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, FALSE); local_offset+=1;
- break;
- case 130:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 130 DataDetails");
- local_offset += 2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, FALSE); local_offset+=1;
- break;
- case 131:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 131 DataDetails");
- local_offset += 2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, FALSE); local_offset+=1;
- break;
- case 144:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 144 DataDetails");
- local_offset +=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
- local_offset +=1;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_OtherLocalChanges, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_CAPABILITYMASK, tvb, local_offset, 4, FALSE); local_offset+=4;
- local_offset +=1;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LinkSpeecEnabledChange, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LinkWidthEnabledChange, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_NodeDescriptionChange, tvb, local_offset, 1, FALSE);
- break;
- case 145:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 145 DataDetails");
- local_offset +=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
- local_offset +=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SYSTEMIMAGEGUID, tvb, local_offset, 8, FALSE); local_offset+=8;
- break;
- case 256:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 256 DataDetails");
- local_offset +=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRSLID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_METHOD, tvb, local_offset, 1, FALSE); local_offset+=1;
- local_offset +=1;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_ATTRIBUTEID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_ATTRIBUTEMODIFIER, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_MKEY, tvb, local_offset, 8, FALSE); local_offset+=8;
- local_offset +=1;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRNotice, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRPathTruncated, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRHopCount, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRNoticeReturnPath, tvb, local_offset, 30, FALSE); local_offset+=30;
- break;
- case 257:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 257 DataDetails");
- local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR1, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR2, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_KEY, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SL, tvb, local_offset, 1, FALSE);
- local_offset +=1;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP1, tvb, local_offset, 3, FALSE); local_offset+=3;
- local_offset +=1;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP2, tvb, local_offset, 3, FALSE); local_offset+=3;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR1, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR2, tvb, local_offset, 16, FALSE); local_offset+=16;
- break;
- case 258:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 258 DataDetails");
- local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR1, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR2, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_KEY, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SL, tvb, local_offset, 1, FALSE);
- local_offset +=1;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP1, tvb, local_offset, 3, FALSE); local_offset+=3;
- local_offset +=1;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP2, tvb, local_offset, 3, FALSE); local_offset+=3;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR1, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR2, tvb, local_offset, 16, FALSE); local_offset+=16;
- break;
- case 259:
- proto_item_set_text(DataDetails_header_item, "%s", "Trap 259 DataDetails");
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DataValid, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR1, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR2, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PKEY, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SL, tvb, local_offset, 1, FALSE);
- local_offset +=1;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP1, tvb, local_offset, 3, FALSE); local_offset+=3;
- local_offset +=1;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP2, tvb, local_offset, 3, FALSE); local_offset+=3;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR1, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR2, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SWLIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, FALSE); local_offset+=1;
- break;
- default:
- proto_item_set_text(DataDetails_header_item, "%s", "Vendor Specific Subnet Management Trap"); local_offset +=54;
- break;
- }
-
-}
-
-/* Parse NoticesAndTraps Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_NoticesAndTraps(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *NoticesAndTraps_header_tree = NULL;
- proto_item *NoticesAndTraps_header_item = NULL;
- guint16 trapNumber = tvb_get_ntohs(tvb, local_offset + 4);
-
- if(!parentTree)
- return;
-
- NoticesAndTraps_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
- proto_item_set_text(NoticesAndTraps_header_item, "%s", val_to_str(trapNumber, Trap_Description, "Unknown or Vendor Specific Trap Number! (0x%02x)"));
- NoticesAndTraps_header_tree = proto_item_add_subtree(NoticesAndTraps_header_item, ett_noticestraps);
-
- proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_IsGeneric, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_Type, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_ProducerTypeVendorID, tvb, local_offset, 3, FALSE); local_offset+=3;
- proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_TrapNumberDeviceID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_IssuerLID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_NoticeToggle, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_NoticeCount, tvb, local_offset, 2, FALSE); local_offset+=2;
-
- parse_NoticeDataDetails(NoticesAndTraps_header_tree, tvb, &local_offset, trapNumber);
- proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_DataDetails, tvb, local_offset, 54, FALSE); local_offset+=54;
-
- /* Only Defined For GMPs not SMPs which is not part of this dissector phase
- *proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_IssuerGID, tvb, local_offset, 16, FALSE); local_offset+=16;
- *proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_ClassTrapSpecificData, tvb, local_offset, 1, FALSE); local_offset+=1; */
-
-}
-
-/* Parse NodeDescription Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_NodeDescription(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *NodeDescription_header_tree = NULL;
-
- if(!parentTree)
- return;
-
- NodeDescription_header_tree = parentTree;
- proto_tree_add_item(NodeDescription_header_tree, hf_infiniband_NodeDescription_NodeString, tvb, local_offset, 64, FALSE);
-}
-
-/* Parse NodeInfo Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_NodeInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *NodeInfo_header_tree = NULL;
-
- if(!parentTree)
- return;
-
- NodeInfo_header_tree = parentTree;
-
- proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_BaseVersion, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_ClassVersion, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_NodeType, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_NumPorts, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_SystemImageGUID, tvb, local_offset, 8, FALSE); local_offset +=8;
- proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_NodeGUID, tvb, local_offset, 8, FALSE); local_offset +=8;
- proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_PortGUID, tvb, local_offset, 8, FALSE); local_offset +=8;
- proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_PartitionCap, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_DeviceID, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_Revision, tvb, local_offset, 4, FALSE); local_offset +=4;
- proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_LocalPortNum, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_VendorID, tvb, local_offset, 3, FALSE); local_offset +=3;
-
-}
-
-/* Parse SwitchInfo Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_SwitchInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *SwitchInfo_header_tree = NULL;
-
- if(!parentTree)
- return;
-
- SwitchInfo_header_tree = parentTree;
-
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LinearFDBCap, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_RandomFDBCap, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_MulticastFDBCap, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LinearFDBTop, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_DefaultPort, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LifeTimeValue, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_PortStateChange, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LIDsPerPort, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_PartitionEnforcementCap, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_InboundEnforcementCap, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_OutboundEnforcementCap, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_FilterRawInboundCap, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_FilterRawOutboundCap, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_EnhancedPortZero, tvb, local_offset, 1, FALSE); local_offset +=1;
-}
-
-/* Parse GUIDInfo Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_GUIDInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *GUIDInfo_header_tree = NULL;
- proto_item *tempItemLow = NULL;
- gint i = 0;
-
- if(!parentTree)
- return;
-
- GUIDInfo_header_tree = parentTree;
-
- for(i = 0; i < 8; i++)
- {
- proto_tree_add_item(GUIDInfo_header_tree, hf_infiniband_GUIDInfo_GUID, tvb, local_offset, 8, FALSE); local_offset +=8;
- proto_item_append_text(tempItemLow, "(%u)", i);
- }
-
-}
-
-/* Parse PortInfo Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_PortInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *PortInfo_header_tree = NULL;
- proto_tree *PortInfo_CapabilityMask_tree = NULL;
- proto_item *PortInfo_CapabilityMask_item = NULL;
- proto_item *temp_item = NULL;
- guint16 temp_val = 0;
-
- if(!parentTree)
- return;
-
- PortInfo_header_tree = parentTree;
-
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_Key, tvb, local_offset, 8, FALSE); local_offset +=8;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_GidPrefix, tvb, local_offset, 8, FALSE); local_offset +=8;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LID, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MasterSMLID, tvb, local_offset, 2, FALSE); local_offset +=2;
-
- /* Capability Mask Flags */
- PortInfo_CapabilityMask_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_CapabilityMask, tvb, local_offset, 4, FALSE);
- PortInfo_CapabilityMask_tree = proto_item_add_subtree(PortInfo_CapabilityMask_item, ett_portinfo_capmask);
-
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SM, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_NoticeSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_TrapSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SMdisabled, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_ReinitSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported, tvb, local_offset, 4, FALSE);
- proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported, tvb, local_offset, 4, FALSE);
- local_offset+=4;
- /* End Capability Mask Flags */
-
- /* Diag Code */
- temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_DiagCode, tvb, local_offset, 2, FALSE);
- temp_val = tvb_get_ntohs(tvb, local_offset);
-
- proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, DiagCode, "Reserved DiagCode! Possible Error"));
- local_offset +=2;
- /* End Diag Code */
-
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_KeyLeasePeriod, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LocalPortNum, tvb, local_offset, 1, FALSE); local_offset +=1;
-
- /* LinkWidthEnabled */
- temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkWidthEnabled, tvb, local_offset, 1, FALSE);
- temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
-
- proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkWidthEnabled, "Reserved LinkWidthEnabled Value! Possible Error"));
- local_offset +=1;
- /* End LinkWidthEnabled */
-
- /* LinkWidthSupported */
- temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkWidthSupported, tvb, local_offset, 1, FALSE);
- temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
-
- proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkWidthSupported, "Reserved LinkWidthSupported Value! Possible Error"));
- local_offset +=1;
- /* End LinkWidthSupported */
-
- /* LinkWidthActive */
- temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkWidthActive, tvb, local_offset, 1, FALSE);
- temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
-
- proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkWidthActive, "Reserved LinkWidthActive Value! Possible Error"));
- local_offset +=1;
- /* End LinkWidthActive */
-
- /* LinkSpeedSupported */
- temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkSpeedSupported, tvb, local_offset, 1, FALSE);
- temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
-
- /* 4 bit values = mask and shift */
- temp_val = temp_val & 0x00F0;
- temp_val = temp_val >> 4;
-
- proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkSpeedSupported, "Reserved LinkWidthSupported Value! Possible Error"));
- /* End LinkSpeedSupported */
-
- /* PortState */
- temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PortState, tvb, local_offset, 1, FALSE);
- temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
-
- /* 4 bit values = mask and shift */
- temp_val = temp_val & 0x000F;
- /*temp_val = temp_val >> 4 */
-
- proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, PortState, "Reserved PortState Value! Possible Error"));
- local_offset +=1;
- /* End PortState */
-
- /* PortPhysicalState */
- temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PortPhysicalState, tvb, local_offset, 1, FALSE);
- temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
-
- /* 4 bit values = mask and shift */
- temp_val = temp_val & 0x00F0;
- temp_val = temp_val >> 4;
-
- proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, PortPhysicalState, "Reserved PortPhysicalState Value! Possible Error"));
- /* End PortPhysicalState */
-
- /* LinkDownDefaultState */
- temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkDownDefaultState, tvb, local_offset, 1, FALSE);
- temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
-
- /* 4 bit values = mask and shift */
- temp_val = temp_val & 0x000F;
- /*temp_val = temp_val >> 4 */
-
- proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkDownDefaultState, "Reserved LinkDownDefaultState Value! Possible Error"));
- local_offset +=1;
- /* End LinkDownDefaultState */
-
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_KeyProtectBits, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LMC, tvb, local_offset, 1, FALSE); local_offset +=1;
-
- /* LinkSpeedActive */
- temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkSpeedActive, tvb, local_offset, 1, FALSE);
- temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
-
- /* 4 bit values = mask and shift */
- temp_val = temp_val & 0x00F0;
- temp_val = temp_val >> 4;
-
- proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkSpeedActive, "Reserved LinkSpeedActive Value! Possible Error"));
- /* End LinkSpeedActive */
-
- /* LinkSpeedEnabled */
- temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkSpeedEnabled, tvb, local_offset, 1, FALSE);
- temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
-
- /* 4 bit values = mask and shift */
- temp_val = temp_val & 0x000F;
- /*temp_val = temp_val >> 4 */
-
- proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkSpeedEnabled, "Reserved LinkSpeedEnabled Value! Possible Error"));
- local_offset +=1;
- /* End LinkSpeedEnabled */
-
- /* NeighborMTU */
- temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_NeighborMTU, tvb, local_offset, 1, FALSE);
- temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
-
- /* 4 bit values = mask and shift */
- temp_val = temp_val & 0x00F0;
- temp_val = temp_val >> 4;
-
- proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, NeighborMTU, "Reserved NeighborMTU Value! Possible Error"));
-
- /* End NeighborMTU */
-
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MasterSMSL, tvb, local_offset, 1, FALSE); local_offset +=1;
-
- /* VLCap */
- temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLCap, tvb, local_offset, 1, FALSE);
- temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
-
- /* 4 bit values = mask and shift */
- temp_val = temp_val & 0x00F0;
- temp_val = temp_val >> 4;
-
- proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, VLCap, "Reserved VLCap Value! Possible Error"));
-
- /* End VLCap */
-
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_InitType, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLHighLimit, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLArbitrationHighCap, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLArbitrationLowCap, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_InitTypeReply, tvb, local_offset, 1, FALSE);
-
- /* MTUCap */
- temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MTUCap, tvb, local_offset, 1, FALSE);
- temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
-
- /* 4 bit values = mask and shift */
- temp_val = temp_val & 0x000F;
- /*temp_val = temp_val >> 4 */
-
- proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, MTUCap, "Reserved MTUCap Value! Possible Error"));
- local_offset +=1;
- /* End MTUCap */
-
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLStallCount, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_HOQLife, tvb, local_offset, 1, FALSE); local_offset +=1;
-
- /* OperationalVLs */
- temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_OperationalVLs, tvb, local_offset, 1, FALSE);
- temp_val = (guint16)tvb_get_guint8(tvb, local_offset);
-
- /* 4 bit values = mask and shift */
- temp_val = temp_val & 0x00F0;
- temp_val = temp_val >> 4;
-
- proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, OperationalVLs, "Reserved OperationalVLs Value! Possible Error"));
- /* End OperationalVLs */
-
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PartitionEnforcementInbound, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PartitionEnforcementOutbound, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_FilterRawInbound, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_FilterRawOutbound, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_KeyViolations, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_P_KeyViolations, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_Q_KeyViolations, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_GUIDCap, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_ClientReregister, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_SubnetTimeOut, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_RespTimeValue, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LocalPhyErrors, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_OverrunErrors, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MaxCreditHint, tvb, local_offset, 2, FALSE); local_offset +=3; /* 2 + 1 Reserved */
- proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkRoundTripLatency, tvb, local_offset, 3, FALSE); local_offset +=3;
-}
-
-/* Parse P_KeyTable Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_P_KeyTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- gint i = 0;
- proto_tree *P_KeyTable_header_tree = NULL;
- proto_item *P_KeyTable_header_item = NULL;
- proto_item *tempItemLow = NULL;
- proto_item *tempItemHigh = NULL;
-
- if(!parentTree)
- return;
-
- P_KeyTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_P_KeyTable_P_KeyTableBlock, tvb, local_offset, 64, FALSE);
- proto_item_set_text(P_KeyTable_header_item, "%s", "P_KeyTable");
- P_KeyTable_header_tree = proto_item_add_subtree(P_KeyTable_header_item, ett_pkeytable);
-
- for(i = 0; i < 32; i++)
- {
- tempItemLow = proto_tree_add_item(P_KeyTable_header_tree, hf_infiniband_P_KeyTable_MembershipType, tvb, local_offset, 1, FALSE);
- tempItemHigh = proto_tree_add_item(P_KeyTable_header_tree, hf_infiniband_P_KeyTable_P_KeyBase, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_item_append_text(tempItemLow, "(%u)", i);
- proto_item_append_text(tempItemHigh,"(%u)", i+1);
- }
-}
-
-/* Parse SLtoVLMappingTable Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_SLtoVLMappingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *SLtoVLMappingTable_header_tree = NULL;
- proto_item *SLtoVLMappingTable_header_item = NULL;
- proto_item *tempItemLow = NULL;
- proto_item *tempItemHigh = NULL;
- gint i = 0;
-
- if(!parentTree)
- return;
-
- SLtoVLMappingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
- proto_item_set_text(SLtoVLMappingTable_header_item, "%s", "SLtoVLMappingTable");
- SLtoVLMappingTable_header_tree = proto_item_add_subtree(SLtoVLMappingTable_header_item, ett_sltovlmapping);
-
- for(i = 0; i < 8; i++)
- {
- tempItemLow = proto_tree_add_item(SLtoVLMappingTable_header_tree, hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits, tvb, local_offset, 1, FALSE);
- tempItemHigh = proto_tree_add_item(SLtoVLMappingTable_header_tree, hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_item_append_text(tempItemLow, "(%u)", i);
- proto_item_append_text(tempItemHigh,"(%u)", i+1);
- }
-}
-
-/* Parse VLArbitrationTable Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_VLArbitrationTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- gint i = 0;
- proto_tree *VLArbitrationTable_header_tree = NULL;
- proto_item *VLArbitrationTable_header_item = NULL;
- proto_item *tempItemLow = NULL;
- proto_item *tempItemHigh = NULL;
-
- if(!parentTree)
- return;
-
- VLArbitrationTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
- proto_item_set_text(VLArbitrationTable_header_item, "%s", "VLArbitrationTable");
- VLArbitrationTable_header_tree = proto_item_add_subtree(VLArbitrationTable_header_item, ett_vlarbitrationtable);
-
- for(i = 0; i < 32; i++)
- {
- tempItemLow = proto_tree_add_item(VLArbitrationTable_header_tree, hf_infiniband_VLArbitrationTable_VL, tvb, local_offset, 1, FALSE); local_offset +=1;
- tempItemHigh = proto_tree_add_item(VLArbitrationTable_header_tree, hf_infiniband_VLArbitrationTable_Weight, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_item_append_text(tempItemLow, "(%u)", i);
- proto_item_append_text(tempItemHigh,"(%u)", i);
- }
-}
-
-/* Parse LinearForwardingTable Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_LinearForwardingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint i = 0;
- gint local_offset = *offset;
- proto_tree *LinearForwardingTable_header_tree = NULL;
- proto_item *LinearForwardingTable_header_item = NULL;
- proto_item *tempItemLow = NULL;
-
- if(!parentTree)
- return;
-
- LinearForwardingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
- proto_item_set_text(LinearForwardingTable_header_item, "%s", "LinearForwardingTable");
- LinearForwardingTable_header_tree = proto_item_add_subtree(LinearForwardingTable_header_item, ett_linearforwardingtable);
-
- for(i = 0; i < 64; i++)
- {
- tempItemLow = proto_tree_add_item(LinearForwardingTable_header_tree, hf_infiniband_LinearForwardingTable_Port, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_item_append_text(tempItemLow, "(%u)", i);
- }
-}
-
-/* Parse RandomForwardingTable Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_RandomForwardingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint i = 0;
- gint local_offset = *offset;
- proto_tree *RandomForwardingTable_header_tree = NULL;
- proto_item *RandomForwardingTable_header_item = NULL;
- proto_item *tempItemLow = NULL;
-
- if(!parentTree)
- return;
-
- RandomForwardingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
- proto_item_set_text(RandomForwardingTable_header_item, "%s", "RandomForwardingTable");
- RandomForwardingTable_header_tree = proto_item_add_subtree(RandomForwardingTable_header_item, ett_randomforwardingtable);
-
- for(i = 0; i < 16; i++)
- {
- tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_LID, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_item_append_text(tempItemLow, "(%u)", i);
- tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_Valid, tvb, local_offset, 1, FALSE);
- proto_item_append_text(tempItemLow, "(%u)", i);
- tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_LMC, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_item_append_text(tempItemLow, "(%u)", i);
- tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_Port, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_item_append_text(tempItemLow, "(%u)", i);
- }
-}
-
-/* Parse NoticesAndTraps Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_MulticastForwardingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint i = 0;
- gint local_offset = *offset;
- proto_tree *MulticastForwardingTable_header_tree = NULL;
- proto_item *MulticastForwardingTable_header_item = NULL;
- proto_item *tempItemLow = NULL;
-
- if(!parentTree)
- return;
-
- MulticastForwardingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
- proto_item_set_text(MulticastForwardingTable_header_item, "%s", "MulticastForwardingTable");
- MulticastForwardingTable_header_tree = proto_item_add_subtree(MulticastForwardingTable_header_item, ett_multicastforwardingtable);
-
- for(i = 0; i < 16; i++)
- {
- tempItemLow = proto_tree_add_item(MulticastForwardingTable_header_tree, hf_infiniband_MulticastForwardingTable_PortMask, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_item_append_text(tempItemLow, "(%u)", i);
- }
-
-}
-
-/* Parse SMInfo Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_SMInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *SMInfo_header_tree = NULL;
- proto_item *SMInfo_header_item = NULL;
-
- if(!parentTree)
- return;
-
- SMInfo_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
- proto_item_set_text(SMInfo_header_item, "%s", "SMInfo");
- SMInfo_header_tree = proto_item_add_subtree(SMInfo_header_item, ett_sminfo);
-
- proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_GUID, tvb, local_offset, 8, FALSE); local_offset +=8;
- proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_SM_Key, tvb, local_offset, 8, FALSE); local_offset +=8;
- proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_ActCount, tvb, local_offset, 4, FALSE); local_offset +=4;
- proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_Priority, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_SMState, tvb, local_offset, 1, FALSE); local_offset +=1;
-}
-
-/* Parse VendorDiag Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_VendorDiag(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *VendorDiag_header_tree = NULL;
- proto_item *VendorDiag_header_item = NULL;
-
- if(!parentTree)
- return;
-
- VendorDiag_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
- proto_item_set_text(VendorDiag_header_item, "%s", "VendorDiag");
- VendorDiag_header_tree = proto_item_add_subtree(VendorDiag_header_item, ett_vendordiag);
-
- proto_tree_add_item(VendorDiag_header_tree, hf_infiniband_VendorDiag_NextIndex, tvb, local_offset, 2, FALSE); local_offset +=2;
- proto_tree_add_item(VendorDiag_header_tree, hf_infiniband_VendorDiag_DiagData, tvb, local_offset, 62, FALSE); local_offset +=62;
-}
-
-/* Parse LedInfo Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_LedInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *LedInfo_header_tree = NULL;
- proto_item *LedInfo_header_item = NULL;
-
- if(!parentTree)
- return;
-
- LedInfo_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
- proto_item_set_text(LedInfo_header_item, "%s", "LedInfo");
- LedInfo_header_tree = proto_item_add_subtree(LedInfo_header_item, ett_ledinfo);
-
- proto_tree_add_item(LedInfo_header_tree, hf_infiniband_LedInfo_LedMask, tvb, local_offset, 1, FALSE);
-}
-
-/* Parse LinkSpeedWidthPairsTable Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_LinkSpeedWidthPairsTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *LinkSpeedWidthPairsTable_header_tree = NULL;
- proto_item *LinkSpeedWidthPairsTable_header_item = NULL;
-
- if(!parentTree)
- return;
-
- LinkSpeedWidthPairsTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
- proto_item_set_text(LinkSpeedWidthPairsTable_header_item, "%s", "LinkSpeedWidthPairsTable");
- LinkSpeedWidthPairsTable_header_tree = proto_item_add_subtree(LinkSpeedWidthPairsTable_header_item, ett_linkspeedwidthpairs);
-
- proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_NumTables, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_PortMask, tvb, local_offset, 32, FALSE); local_offset +=32;
- proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive, tvb, local_offset, 1, FALSE); local_offset +=1;
- proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen, tvb, local_offset, 1, FALSE); local_offset +=1;
-}
-
-/* Parse RID Field from Subnet Administraiton Packets.
-* IN: SA_header_tree - the dissection tree of the subnet admin attribute.
-* tvb - the packet buffer
-* MadHeader - the Common MAD header from this packet.
-* IN/OUT: offset - the current and updated offset in the packet buffer */
-static void parse_RID(proto_tree* SA_header_tree, tvbuff_t* tvb, gint *offset, MAD_Data* MadHeader)
-{
- gint local_offset = *offset;
- if(!SA_header_tree)
- {
- return;
- }
- switch(MadHeader->attributeID)
- {
- case 0x0011:
- /* NodeRecord */
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
- local_offset+=2; /* Reserved bits */
- break;
- case 0x0012:
- /* PortInfoRecord */
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_EndportLID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_PortNum, tvb, local_offset, 1, FALSE); local_offset+=1;
- local_offset+=1; /* Reserved bits */
- break;
- case 0x0013:
- /* SLtoVLMappingTableRecord */
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_InputPortNum, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_OutputPortNum, tvb, local_offset, 1, FALSE); local_offset+=1;
- local_offset+=4; /* Reserved bits */
- break;
- case 0x0014:
- /* SwitchInfoRecord */
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
- local_offset+=2; /* Reserved bits */
- break;
- case 0x0015:
- /* LinearForwardingTableRecord */
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_SixteenBit, tvb, local_offset, 2, FALSE); local_offset+=2;
- local_offset+=4; /* Reserved bits */
- break;
- case 0x0016:
- /* RandomForwardingTableRecord */
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_SixteenBit, tvb, local_offset, 2, FALSE); local_offset+=2;
- local_offset+=4; /* Reserved bits */
- break;
- case 0x0017:
- /* MulticastForwardingTableRecord */
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_Position, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_NineBit, tvb, local_offset, 2, FALSE); local_offset+=2;
- local_offset+=4; /* Reserved bits */
- break;
- case 0x0036:
- /*VLArbitrationTableRecord */
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_OutputPortNum, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_EightBit, tvb, local_offset, 1, FALSE); local_offset+=1;
- local_offset+=4; /* Reserved bits */
- break;
- case 0x0018:
- /* SMInfoRecord */
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
- local_offset+=2; /* Reserved bits */
- break;
- case 0x0033:
- /* P_KeyTableRecord */
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_SixteenBit, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_PortNum, tvb, local_offset, 1, FALSE); local_offset+=1;
- local_offset+=3; /* Reserved bits */
- break;
- case 0x00F3:
- /* InformInfoRecord */
- proto_tree_add_item(SA_header_tree, hf_infiniband_InformInfoRecord_SubscriberGID, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_tree_add_item(SA_header_tree, hf_infiniband_InformInfoRecord_Enum, tvb, local_offset, 2, FALSE); local_offset+=2;
- local_offset+=6; /* Reserved bits */
- break;
- case 0x0020:
- /* LinkRecord */
- proto_tree_add_item(SA_header_tree, hf_infiniband_LinkRecord_FromLID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(SA_header_tree, hf_infiniband_LinkRecord_FromPort, tvb, local_offset, 1, FALSE); local_offset+=1;
- break;
- case 0x0031:
- /* ServiceRecord */
- proto_tree_add_item(SA_header_tree, hf_infiniband_ServiceRecord_ServiceID, tvb, local_offset, 8, FALSE); local_offset+=8;
- proto_tree_add_item(SA_header_tree, hf_infiniband_ServiceRecord_ServiceGID, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_tree_add_item(SA_header_tree, hf_infiniband_ServiceRecord_ServiceP_Key, tvb, local_offset, 2, FALSE); local_offset+=2;
- local_offset+=2;
- break;
- case 0x0038:
- /* MCMemberRecord */
- proto_tree_add_item(SA_header_tree, hf_infiniband_MCMemberRecord_MGID, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_tree_add_item(SA_header_tree, hf_infiniband_MCMemberRecord_PortGID, tvb, local_offset, 16, FALSE); local_offset+=16;
- break;
- case 0x0030:
- /* GuidInfoRecord */
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_EightBit, tvb, local_offset, 1, FALSE); local_offset+=2;
- local_offset+=4;
- break;
- default:
- break;
- }
-
- *offset = local_offset;
-}
-
-/* Parse InformInfo Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_InformInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *InformInfo_header_tree = NULL;
- proto_item *InformInfo_header_item = NULL;
- if(!parentTree)
- {
- return;
- }
- InformInfo_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 36, FALSE);
- proto_item_set_text(InformInfo_header_item, "%s", "InformInfo");
- InformInfo_header_tree = proto_item_add_subtree(InformInfo_header_item, ett_informinfo);
-
- proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_GID, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_LIDRangeBegin, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_LIDRangeEnd, tvb, local_offset, 2, FALSE); local_offset+=2;
- local_offset+=2; /* Reserved Bits */
- proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_IsGeneric, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_Subscribe, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_Type, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_TrapNumberDeviceID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_QPN, tvb, local_offset, 3, FALSE); local_offset+=3;
- proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_RespTimeValue, tvb, local_offset, 1, FALSE); local_offset+=1;
- local_offset+=1;
- proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_ProducerTypeVendorID, tvb, local_offset, 3, FALSE); local_offset+=3;
-
-}
-/* Parse LinkRecord Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_LinkRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *LinkRecord_header_tree = NULL;
- proto_item *LinkRecord_header_item = NULL;
-
- if(!parentTree)
- {
- return;
- }
-
- LinkRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 3, FALSE);
- proto_item_set_text(LinkRecord_header_item, "%s", "LinkRecord");
- LinkRecord_header_tree = proto_item_add_subtree(LinkRecord_header_item, ett_linkrecord);
-
- proto_tree_add_item(LinkRecord_header_tree, hf_infiniband_LinkRecord_ToPort, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(LinkRecord_header_tree, hf_infiniband_LinkRecord_ToLID, tvb, local_offset, 2, FALSE); local_offset +=2;
-
-}
-/* Parse ServiceRecord Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_ServiceRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *ServiceRecord_header_tree = NULL;
- proto_item *ServiceRecord_header_item = NULL;
- proto_item *tempData = NULL;
-
- if(!parentTree)
- {
- return;
- }
-
- ServiceRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 176, FALSE);
- proto_item_set_text(ServiceRecord_header_item, "%s", "ServiceRecord");
- ServiceRecord_header_tree = proto_item_add_subtree(ServiceRecord_header_item, ett_servicerecord);
-
- proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceLease, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceKey, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceName, tvb, local_offset, 64, FALSE); local_offset+=64;
-
- tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_item_append_text(tempData, "%s", "(ServiceData 8.1, 8.16)");
- tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_item_append_text(tempData, "%s", "(ServiceData 16.1, 16.8)");
- tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_item_append_text(tempData, "%s", "(ServiceData 32.1, 32.4)");
- tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_item_append_text(tempData, "%s", "(ServiceData 64.1, 64.2)");
-
-}
-/* Parse PathRecord Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_PathRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *PathRecord_header_tree = NULL;
- proto_item *PathRecord_header_item = NULL;
-
- if(!parentTree)
- {
- return;
- }
-
- PathRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 64, FALSE);
- proto_item_set_text(PathRecord_header_item, "%s", "PathRecord");
- PathRecord_header_tree = proto_item_add_subtree(PathRecord_header_item, ett_pathrecord);
- local_offset += 8; /* Reserved Bits */
-
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_DGID, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_SGID, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_DLID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_SLID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_RawTraffic, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_FlowLabel, tvb, local_offset, 3, FALSE); local_offset+=3;
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_HopLimit, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_TClass, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_Reversible, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_NumbPath, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_P_Key, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_SL, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_MTUSelector, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_MTU, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_RateSelector, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_Rate, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_PacketLifeTimeSelector, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_PacketLifeTime, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_Preference, tvb, local_offset, 1, FALSE); local_offset+=1;
-}
-/* Parse MCMemberRecord Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_MCMemberRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *MCMemberRecord_header_tree = NULL;
- proto_item *MCMemberRecord_header_item = NULL;
-
- if(!parentTree)
- {
- return;
- }
-
- MCMemberRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 64, FALSE);
- proto_item_set_text(MCMemberRecord_header_item, "%s", "MCMemberRecord");
- MCMemberRecord_header_tree = proto_item_add_subtree(MCMemberRecord_header_item, ett_mcmemberrecord);
-
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_Q_Key, tvb, local_offset, 4, FALSE); local_offset+=4;
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_MLID, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_MTUSelector, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_MTU, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_TClass, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_P_Key, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_RateSelector, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_Rate, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_PacketLifeTimeSelector, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_PacketLifeTime, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_SL, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_FlowLabel, tvb, local_offset, 3, FALSE); local_offset+=3;
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_HopLimit, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_Scope, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_JoinState, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_ProxyJoin, tvb, local_offset, 1, FALSE); local_offset+=3;
-
-}
-/* Parse TraceRecord Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_TraceRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *TraceRecord_header_tree = NULL;
- proto_item *TraceRecord_header_item = NULL;
-
- if(!parentTree)
- {
- return;
- }
-
- TraceRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 46, FALSE);
- proto_item_set_text(TraceRecord_header_item, "%s", "TraceRecord");
- TraceRecord_header_tree = proto_item_add_subtree(TraceRecord_header_item, ett_tracerecord);
-
- proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_GIDPrefix, tvb, local_offset, 8, FALSE); local_offset+=8;
- proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_IDGeneration, tvb, local_offset, 2, FALSE); local_offset+=2;
- local_offset+=1; /* Reserved Bits */
- proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_NodeType, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_NodeID, tvb, local_offset, 8, FALSE); local_offset+=8;
- proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_ChassisID, tvb, local_offset, 8, FALSE); local_offset+=8;
- proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_EntryPortID, tvb, local_offset, 8, FALSE); local_offset+=8;
- proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_ExitPortID, tvb, local_offset, 8, FALSE); local_offset+=8;
- proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_EntryPort, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_ExitPort, tvb, local_offset, 1, FALSE); local_offset+=1;
-}
-/* Parse MultiPathRecord Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_MultiPathRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *MultiPathRecord_header_tree = NULL;
- proto_item *MultiPathRecord_header_item = NULL;
- proto_item *SDGID = NULL;
- guint8 SDGIDCount = 0;
- guint8 DGIDCount = 0;
- guint32 i = 0;
-
- if(!parentTree)
- {
- return;
- }
-
- MultiPathRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 200, FALSE);
- proto_item_set_text(MultiPathRecord_header_item, "%s", "MultiPathRecord");
- MultiPathRecord_header_tree = proto_item_add_subtree(MultiPathRecord_header_item, ett_multipathrecord);
-
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_RawTraffic, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_FlowLabel, tvb, local_offset, 3, FALSE); local_offset+=3;
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_HopLimit, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_TClass, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_Reversible, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_NumbPath, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_P_Key, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SL, tvb, local_offset, 2, FALSE); local_offset+=2;
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_MTUSelector, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_MTU, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_RateSelector, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_Rate, tvb, local_offset, 1, FALSE); local_offset+=1;
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_PacketLifeTimeSelector, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_PacketLifeTime, tvb, local_offset, 1, FALSE); local_offset+=1;
- local_offset+=1; /* Reserved Bits */
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_IndependenceSelector, tvb, local_offset, 1, FALSE);
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_GIDScope, tvb, local_offset, 1, FALSE); local_offset+=1;
-
- SDGIDCount = tvb_get_guint8(tvb, local_offset);
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SGIDCount, tvb, local_offset, 1, FALSE); local_offset+=1;
- DGIDCount = tvb_get_guint8(tvb, local_offset);
- proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_DGIDCount, tvb, local_offset, 1, FALSE); local_offset+=1;
- local_offset+=7; /*Reserved Bits */
-
- for(i = 0; i < SDGIDCount; i++)
- {
- SDGID = proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SDGID, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_item_set_text(SDGID, "(%s%u)","SGID", i);
- }
- for(i = 0; i < DGIDCount; i++)
- {
- SDGID = proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SDGID, tvb, local_offset, 16, FALSE); local_offset+=16;
- proto_item_set_text(SDGID, "(%s%u)","DGID", i);
- }
-}
-/* Parse ServiceAssociationRecord Attribute
-* IN: parentTree - The tree to add the dissection to
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* MadHeader - The common MAD header of the current SMP/SMA */
-static void parse_ServiceAssociationRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
-{
- gint local_offset = *offset;
- proto_tree *ServiceAssociationRecord_header_tree = NULL;
- proto_item *ServiceAssociationRecord_header_item = NULL;
-
- if(!parentTree)
- {
- return;
- }
-
- ServiceAssociationRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 80, FALSE);
- proto_item_set_text(ServiceAssociationRecord_header_item, "%s", "ServiceAssociationRecord");
- ServiceAssociationRecord_header_tree = proto_item_add_subtree(ServiceAssociationRecord_header_item, ett_serviceassocrecord);
-
- proto_tree_add_item(ServiceAssociationRecord_header_tree, hf_infiniband_ServiceAssociationRecord_ServiceKey, tvb, local_offset, 16, FALSE); local_offset +=16;
- proto_tree_add_item(ServiceAssociationRecord_header_tree, hf_infiniband_ServiceAssociationRecord_ServiceName, tvb, local_offset, 64, FALSE); local_offset +=64;
-}
-
-/* dissect_general_info
-* Used to extract very few values from the packet in the case that full dissection is disabled by the user.
-* IN:
-* tvb - The tvbbuff of packet data
-* offset - The offset in TVB where the attribute begins
-* pinfo - The packet info structure with column information */
-static void dissect_general_info(tvbuff_t *tvb, gint offset, packet_info *pinfo)
-{
- guint8 lnh_val = 0; /* The Link Next Header Value. Tells us which headers are coming */
- gboolean bthFollows = 0; /* Tracks if we are parsing a BTH. This is a significant decision point */
- guint8 virtualLane = 0; /* The Virtual Lane of the current Packet */
- guint8 opCode = 0; /* OpCode from BTH header. */
- gint32 nextHeaderSequence = -1; /* defined by this dissector. #define which indicates the upcoming header sequence from OpCode */
- guint8 nxtHdr = 0; /* that must be available for that header. */
- struct e_in6_addr SRCgid; /* Struct to display ipv6 Address */
- struct e_in6_addr DSTgid; /* Struct to display ipv6 Address */
- guint8 management_class = 0;
- MAD_Data MadData;
-
-
- virtualLane = tvb_get_guint8(tvb, offset);
- virtualLane = virtualLane & 0xF0;
- offset+=1;
-
- /* Save Link Next Header... This tells us what the next header is. */
- lnh_val = tvb_get_guint8(tvb, offset);
- lnh_val = lnh_val & 0x03;
- offset+=1;
-
- /* Set destination in packet view. */
- if (check_col(pinfo->cinfo, COL_DEF_DST))
- {
- col_add_fstr(pinfo->cinfo, COL_DEF_DST, "DLID: %s", tvb_bytes_to_str(tvb, offset, 2));
- }
- offset+=4;
-
- /* Set Source in packet view. */
- if (check_col(pinfo->cinfo, COL_DEF_SRC))
- {
- col_add_fstr(pinfo->cinfo, COL_DEF_SRC, "SLID: %s", tvb_bytes_to_str(tvb, offset, 2));
- }
- offset+=2;
-
- switch(lnh_val)
- {
- case IBA_GLOBAL:
- offset +=6;
- nxtHdr = tvb_get_guint8(tvb, offset);
- offset += 2;
-
- tvb_get_ipv6(tvb, offset, &SRCgid);
- if (check_col(pinfo->cinfo, COL_DEF_SRC))
- {
- col_add_fstr(pinfo->cinfo, COL_DEF_SRC, "SGID: %s", ip6_to_str(&SRCgid));
- }
- offset += 16;
-
- tvb_get_ipv6(tvb, offset, &DSTgid);
- if (check_col(pinfo->cinfo, COL_DEF_DST))
- {
- col_add_fstr(pinfo->cinfo, COL_DEF_DST, "DGID: %s", ip6_to_str(&DSTgid));
- }
- offset += 16;
-
- if(nxtHdr != 0x1B)
- {
- /* Some kind of packet being transported globally with IBA, but locally it is not IBA - no BTH following. */
- break;
- }
- /* else
- * {
- * Fall through switch and start parsing Local Headers and BTH
- * }
- */
- case IBA_LOCAL:
- bthFollows = TRUE;
-
- /* Get the OpCode - this tells us what headers are following */
- opCode = tvb_get_guint8(tvb, offset);
- if (check_col(pinfo->cinfo, COL_INFO))
- {
- col_append_str(pinfo->cinfo, COL_INFO, val_to_str((guint32)opCode, OpCodeMap, "Unknown OpCode"));
- }
- offset +=12;
- break;
- case IP_NON_IBA:
- /* Raw IPv6 Packet */
- if (check_col(pinfo->cinfo, COL_DEF_DST))
- {
- col_set_str(pinfo->cinfo, COL_DEF_DST, "IPv6 over IB Packet");
- col_set_fence(pinfo->cinfo, COL_DEF_DST);
- }
- break;
- case RAW:
- break;
- default:
- break;
- }
-
- if(bthFollows)
- {
- /* Find our next header sequence based on the Opcode
- * Since we're not doing dissection here, we just need the proper offsets to get our labels in packet view */
-
- nextHeaderSequence = find_next_header_sequence((guint32) opCode);
- switch(nextHeaderSequence)
- {
- case RDETH_DETH_PAYLD:
- offset += 4; /* RDETH */
- offset += 8; /* DETH */
- break;
- case RDETH_DETH_RETH_PAYLD:
- offset += 4; /* RDETH */
- offset += 8; /* DETH */
- offset += 16; /* RETH */
- break;
- case RDETH_DETH_IMMDT_PAYLD:
- offset += 4; /* RDETH */
- offset += 8; /* DETH */
- offset += 4; /* IMMDT */
- break;
- case RDETH_DETH_RETH_IMMDT_PAYLD:
- offset += 4; /* RDETH */
- offset += 8; /* DETH */
- offset += 16; /* RETH */
- offset += 4; /* IMMDT */
- break;
- case RDETH_DETH_RETH:
- offset += 4; /* RDETH */
- offset += 8; /* DETH */
- offset += 16; /* RETH */
- break;
- case RDETH_AETH_PAYLD:
- offset += 4; /* RDETH */
- offset += 4; /* AETH */
- break;
- case RDETH_PAYLD:
- offset += 4; /* RDETH */
- break;
- case RDETH_AETH:
- offset += 4; /* RDETH */
- offset += 4; /* AETH */
- break;
- case RDETH_AETH_ATOMICACKETH:
- offset += 4; /* RDETH */
- offset += 4; /* AETH */
- offset += 8; /* AtomicAckETH */
- break;
- case RDETH_DETH_ATOMICETH:
- offset += 4; /* RDETH */
- offset += 8; /* DETH */
- offset += 28; /* AtomicETH */
- break;
- case RDETH_DETH:
- offset += 4; /* RDETH */
- offset += 8; /* DETH */
- break;
- case DETH_PAYLD:
- offset += 8; /* DETH */
- break;
- case PAYLD:
- break;
- case IMMDT_PAYLD:
- offset += 4; /* IMMDT */
- break;
- case RETH_PAYLD:
- offset += 16; /* RETH */
- break;
- case RETH:
- offset += 16; /* RETH */
- break;
- case AETH_PAYLD:
- offset += 4; /* AETH */
- break;
- case AETH:
- offset += 4; /* AETH */
- break;
- case AETH_ATOMICACKETH:
- offset += 4; /* AETH */
- offset += 8; /* AtomicAckETH */
- break;
- case ATOMICETH:
- offset += 28; /* AtomicETH */
- break;
- case IETH_PAYLD:
- offset += 4; /* IETH */
- break;
- case DETH_IMMDT_PAYLD:
- offset += 8; /* DETH */
- offset += 4; /* IMMDT */
- break;
- default:
- break;
- }
- }
- if(virtualLane == 0xF0)
- {
- management_class = tvb_get_guint8(tvb, offset + 1);
- if(((management_class >= (guint8)VENDOR_1_START) && (management_class <= (guint8)VENDOR_1_END))
- || ((management_class >= (guint8)VENDOR_2_START) && (management_class <= (guint8)VENDOR_2_END)))
- {
- return;
- }
- else if((management_class >= (guint8)APPLICATION_START) && (management_class <= (guint8)APPLICATION_END))
- {
- return;
- }
- else if(((management_class == (guint8)0x00) || (management_class == (guint8)0x02))
- || ((management_class >= (guint8)0x50) && (management_class <= (guint8)0x80))
- || ((management_class >= (guint8)0x82)))
- {
- return;
- }
- else /* we have a normal management_class */
- {
- parse_MAD_Common(NULL, tvb, &offset, &MadData);
- label_SUBM_Method(NULL, &MadData, pinfo);
- label_SUBM_Attribute(NULL, &MadData, pinfo);
- }
- }
-
- return;
-}
diff --git a/plugins/infiniband/packet-infiniband.h b/plugins/infiniband/packet-infiniband.h
deleted file mode 100644
index 329c31abd1..0000000000
--- a/plugins/infiniband/packet-infiniband.h
+++ /dev/null
@@ -1,2571 +0,0 @@
-/* packet-infiniband.h
- * Routines for Infiniband/ERF Dissection
- *
- * $Id$
- *
- * Copyright 2008 Endace Technology Limited
- *
- * This program is free software; you can redistribute it and/or
- * modify it under the terms of the GNU General Public License
- * as published by the Free Software Foundation; either version 2
- * of the License, or (at your option) any later version.
- *
- * This program is distributed in the hope that it will be useful,
- * but WITHOUT ANY WARRANTY; without even the implied warranty of
- * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
- * GNU General Public License for more details.
- *
- * You should have received a copy of the GNU General Public License
- * along with this program; if not, write to the Free Software
- * Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.
- */
-#ifndef __PACKET_INFINIBAND_H_
-#define __PACKET_INFINIBAND_H_
-
-#define PROTO_TAG_INFINIBAND "Infiniband"
-
-#include <epan/etypes.h>
-
-/* Wireshark ID */
-static int proto_infiniband = -1;
-
-/* Variables to hold expansion values between packets */
-static gint ett_infiniband = -1;
-static gint ett_all_headers = -1;
-static gint ett_lrh = -1;
-static gint ett_grh = -1;
-static gint ett_bth = -1;
-static gint ett_rwh = -1;
-static gint ett_rawdata = -1;
-static gint ett_rdeth = -1;
-static gint ett_deth = -1;
-static gint ett_reth = -1;
-static gint ett_atomiceth = -1;
-static gint ett_aeth = -1;
-static gint ett_atomicacketh = -1;
-static gint ett_immdt = -1;
-static gint ett_ieth = -1;
-static gint ett_payload = -1;
-static gint ett_vendor = -1;
-static gint ett_subn_lid_routed = -1;
-static gint ett_subn_directed_route = -1;
-static gint ett_subnadmin = -1;
-static gint ett_mad = -1;
-static gint ett_rmpp = -1;
-static gint ett_subm_attribute = -1;
-static gint ett_suba_attribute = -1;
-static gint ett_datadetails = -1;
-static gint ett_noticestraps = -1;
-static gint ett_nodedesc = -1;
-static gint ett_nodeinfo = -1;
-static gint ett_switchinfo = -1;
-static gint ett_guidinfo = -1;
-static gint ett_portinfo = -1;
-static gint ett_portinfo_capmask = -1;
-static gint ett_pkeytable = -1;
-static gint ett_sltovlmapping = -1;
-static gint ett_vlarbitrationtable = -1;
-static gint ett_linearforwardingtable = -1;
-static gint ett_randomforwardingtable = -1;
-static gint ett_multicastforwardingtable = -1;
-static gint ett_sminfo = -1;
-static gint ett_vendordiag = -1;
-static gint ett_ledinfo = -1;
-static gint ett_linkspeedwidthpairs = -1;
-static gint ett_informinfo = -1;
-static gint ett_linkrecord = -1;
-static gint ett_servicerecord = -1;
-static gint ett_pathrecord = -1;
-static gint ett_mcmemberrecord = -1;
-static gint ett_tracerecord = -1;
-static gint ett_multipathrecord = -1;
-static gint ett_serviceassocrecord = -1;
-
-/* Global ref to highest level tree should we find other protocols encapsulated in IB */
-static proto_tree *top_tree = NULL;
-
-/* MAD_Data
-* Structure to hold information from the common MAD header.
-* This is necessary because the MAD header contains information which significantly changes the dissection algorithm. */
-typedef struct {
- guint8 managementClass;
- guint8 classVersion;
- guint8 method;
- guint8 status;
- guint16 classSpecific;
- guint64 transactionID;
- guint16 attributeID;
- guint32 attributeModifier;
- char data[232];
-} MAD_Data;
-
-/* Dissector Declarations */
-static dissector_handle_t ipv6_handle;
-static dissector_handle_t data_handle;
-static dissector_table_t ethertype_dissector_table;
-
-static void dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree);
-static gint32 find_next_header_sequence(guint32 OpCode);
-static gboolean contains(guint32 value, guint32* arr, int length);
-static void dissect_general_info(tvbuff_t *tvb, gint offset, packet_info *pinfo);
-
-/* Parsing Methods for specific IB headers. */
-
-static void parse_VENDOR(proto_tree *, tvbuff_t *, gint *);
-static void parse_PAYLOAD(proto_tree *, packet_info *, tvbuff_t *, gint *, gint length, guint8 virtualLane);
-static void parse_IETH(proto_tree *, tvbuff_t *, gint *);
-static void parse_IMMDT(proto_tree *, tvbuff_t *, gint *offset);
-static void parse_ATOMICACKETH(proto_tree *, tvbuff_t *, gint *offset);
-static void parse_AETH(proto_tree *, tvbuff_t *, gint *offset);
-static void parse_ATOMICETH(proto_tree *, tvbuff_t *, gint *offset);
-static void parse_RETH(proto_tree *, tvbuff_t *, gint *offset);
-static void parse_DETH(proto_tree *, tvbuff_t *, gint *offset);
-static void parse_RDETH(proto_tree *, tvbuff_t *, gint *offset);
-static void parse_IPvSix(proto_tree *, tvbuff_t *, gint *offset, packet_info *);
-static void parse_RWH(proto_tree *, tvbuff_t *, gint *offset, packet_info *);
-
-static void parse_SUBN_LID_ROUTED(proto_tree *, packet_info *, tvbuff_t *, gint *offset);
-static void parse_SUBN_DIRECTED_ROUTE(proto_tree *, packet_info *, tvbuff_t *, gint *offset);
-static void parse_SUBNADMN(proto_tree *, packet_info *, tvbuff_t *, gint *offset);
-static void parse_PERF(proto_tree *, tvbuff_t *, gint *offset);
-static void parse_BM(proto_tree *, tvbuff_t *, gint *offset);
-static void parse_DEV_MGT(proto_tree *, tvbuff_t *, gint *offset);
-static void parse_COM_MGT(proto_tree *, tvbuff_t *, gint *offset);
-static void parse_SNMP(proto_tree *, tvbuff_t *, gint *offset);
-static void parse_VENDOR_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset);
-static void parse_APPLICATION_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset);
-static void parse_RESERVED_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset);
-
-static gboolean parse_MAD_Common(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
-static gboolean parse_RMPP(proto_tree* , tvbuff_t* , gint *offset);
-static void label_SUBM_Method(proto_item*, MAD_Data*, packet_info*);
-static void label_SUBM_Attribute(proto_item*, MAD_Data*, packet_info*);
-static void label_SUBA_Method(proto_item*, MAD_Data*, packet_info*);
-static void label_SUBA_Attribute(proto_item*, MAD_Data*, packet_info*);
-
-/* Class Attribute Parsing Routines */
-static gboolean parse_SUBM_Attribute(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
-static gboolean parse_SUBA_Attribute(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
-
-/* These methods parse individual attributes
-* Naming convention FunctionHandle = "parse_" + [Attribute Name];
-* Where [Attribute Name] is the attribute identifier from chapter 14 of the IB Specification
-* Subnet Management */
-static void parse_NoticesAndTraps(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_NodeDescription(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_NodeInfo(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_SwitchInfo(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_GUIDInfo(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_PortInfo(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_P_KeyTable(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_SLtoVLMappingTable(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_VLArbitrationTable(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_LinearForwardingTable(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_RandomForwardingTable(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_MulticastForwardingTable(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_SMInfo(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_VendorDiag(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_LedInfo(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_LinkSpeedWidthPairsTable(proto_tree*, tvbuff_t*, gint *offset);
-
-/* Subnet Administration */
-static void parse_InformInfo(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_LinkRecord(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_ServiceRecord(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_PathRecord(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_MCMemberRecord(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_TraceRecord(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_MultiPathRecord(proto_tree*, tvbuff_t*, gint *offset);
-static void parse_ServiceAssociationRecord(proto_tree*, tvbuff_t*, gint *offset);
-
-/* Subnet Administration */
-static void parse_RID(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*);
-
-/* SM Methods */
-static const value_string SUBM_Methods[] = {
- { 0x01, "SubnGet("},
- { 0x02, "SubnSet("},
- { 0x81, "SubnGetResp("},
- { 0x05, "SubnTrap("},
- { 0x07, "SubnTrapResp("},
- { 0, NULL}
-};
-/* SM Attributes */
-static const value_string SUBM_Attributes[] = {
- { 0x0001, "Attribute (ClassPortInfo)"},
- { 0x0002, "Attribute (Notice)"},
- { 0x0003, "Attribute (InformInfo)"},
- { 0x0010, "Attribute (NodeDescription)"},
- { 0x0011, "Attribute (NodeInfo)"},
- { 0x0012, "Attribute (SwitchInfo)"},
- { 0x0014, "Attribute (GUIDInfo)"},
- { 0x0015, "Attribute (PortInfo)"},
- { 0x0016, "Attribute (P_KeyTable)"},
- { 0x0017, "Attribute (SLtoVLMapptingTable)"},
- { 0x0018, "Attribute (VLArbitrationTable)"},
- { 0x0019, "Attribute (LinearForwardingTable)"},
- { 0x001A, "Attribute (RandomForwardingTable)"},
- { 0x001B, "Attribute (MulticastForwardingTable)"},
- { 0x001C, "Attribute (LinkSpeedWidthPairsTable)"},
- { 0x0020, "Attribute (SMInfo)"},
- { 0x0030, "Attribute (VendorDiag)"},
- { 0x0031, "Attribute (LedInfo)"},
- { 0, NULL}
-};
-
-/* SA Methods */
-static const value_string SUBA_Methods[] = {
- { 0x01, "SubnAdmGet("},
- { 0x81, "SubnAdmGetResp("},
- { 0x02, "SubnAdmSet("},
- { 0x06, "SubnAdmReport("},
- { 0x86, "SubnAdmReportResp("},
- { 0x12, "SubnAdmGetTable("},
- { 0x92, "SubnAdmGetTableResp("},
- { 0x13, "SubnAdmGetTraceTable("},
- { 0x14, "SubnAdmGetMulti("},
- { 0x94, "SubnAdmGetMultiResp("},
- { 0x15, "SubnAdmDelete("},
- { 0x95, "SubnAdmDeleteResp("},
- { 0, NULL}
-};
-/* SA Attributes */
-static const value_string SUBA_Attributes[] = {
- { 0x0001, "Attribute (ClassPortInfo)"},
- { 0x0002, "Attribute (Notice)"},
- { 0x0003, "Attribute (InformInfo)"},
- { 0x0011, "Attribute (NodeRecord)"},
- { 0x0012, "Attribute (PortInfoRecord)"},
- { 0x0013, "Attribute (SLtoVLMappingTableRecord)"},
- { 0x0014, "Attribute (SwitchInfoRecord)"},
- { 0x0015, "Attribute (LinearForwardingTableRecord)"},
- { 0x0016, "Attribute (RandomForwardingTableRecord)"},
- { 0x0017, "Attribute (MulticastForwardingTableRecord)"},
- { 0x0018, "Attribute (SMInfoRecord)"},
- { 0x0019, "Attribute (LinkSpeedWidthPairsTableRecord)"},
- { 0x00F3, "Attribute (InformInfoRecord)"},
- { 0x0020, "Attribute (LinkRecord)"},
- { 0x0030, "Attribute (GuidInfoRecord)"},
- { 0x0031, "Attribute (ServiceRecord)"},
- { 0x0033, "Attribute (P_KeyTableRecord)"},
- { 0x0035, "Attribute (PathRecord)"},
- { 0x0036, "Attribute (VLArbitrationTableRecord)"},
- { 0x0038, "Attribute (MCMembersRecord)"},
- { 0x0039, "Attribute (TraceRecord)"},
- { 0x003A, "Attribute (MultiPathRecord)"},
- { 0x003B, "Attribute (ServiceAssociationRecord)"},
- { 0, NULL}
-};
-
-
-/* RMPP Types */
-#define RMPP_ILLEGAL 0
-#define RMPP_DATA 1
-#define RMPP_ACK 2
-#define RMPP_STOP 3
-#define RMPP_ABORT 4
-
-static const value_string RMPP_Packet_Types[] = {
- { RMPP_ILLEGAL, " Illegal RMPP Type (0)! " },
- { RMPP_DATA, "RMPP (DATA)" },
- { RMPP_ACK, "RMPP (ACK)" },
- { RMPP_STOP, "RMPP (STOP)" },
- { RMPP_ABORT, "RMPP (ABORT)" },
- { 0, NULL}
-};
-
-static const value_string RMPP_Flags[] = {
- { 3, " (Transmission Sequence - First Packet)"},
- { 5, " (Transmission Sequence - Last Packet)"},
- { 1, " (Transmission Sequence) " },
- { 0, NULL}
-};
-
-static const value_string RMPP_Status[]= {
- { 0, " (Normal)"},
- { 1, " (Resources Exhausted)"},
- { 118, " (Total Time Too Long)"},
- { 119, " (Inconsistent Last and PayloadLength)"},
- { 120, " (Inconsistent First and Segment Number)"},
- { 121, " (Bad RMPPType)"},
- { 122, " (NewWindowLast Too Small)"},
- { 123, " (SegmentNumber Too Big)"},
- { 124, " (Illegal Status)"},
- { 125, " (Unsupported Version)"},
- { 126, " (Too Many Retries)"},
- { 127, " (Unspecified - Unknown Error Code on ABORT)"},
- { 0, NULL}
-};
-
-static const value_string DiagCode[]= {
- {0x0000, "Function Ready"},
- {0x0001, "Performing Self Test"},
- {0x0002, "Initializing"},
- {0x0003, "Soft Error - Function has non-fatal error"},
- {0x0004, "Hard Error - Function has fatal error"},
- { 0, NULL}
-};
-static const value_string LinkWidthEnabled[]= {
- {0x0000, "No State Change"},
- {0x0001, "1x"},
- {0x0002, "4x"},
- {0x0003, "1x or 4x"},
- {0x0004, "8x"},
- {0x0005, "1x or 8x"},
- {0x0006, "4x or 8x"},
- {0x0007, "1x or 4x or 8x"},
- {0x0008, "12x"},
- {0x0009, "1x or 12x"},
- {0x000A, "4x or 12x"},
- {0x000B, "1x or 4x or 12x"},
- {0x000C, "8x or 12x"},
- {0x000D, "1x or 8x or 12x"},
- {0x000E, "4x or 8x or 12x"},
- {0x000E, "1x or 4x or 8x or 12x"},
- {0x00FF, "Set to LinkWidthSupported Value - Response contains actual LinkWidthSupported"},
- { 0, NULL}
-};
-
-static const value_string LinkWidthSupported[]= {
- {0x0001, "1x"},
- {0x0003, "1x or 4x"},
- {0x0007, "1x or 4x or 8x"},
- {0x000B, "1x or 4x or 12x"},
- {0x000F, "1x or 4x or 8x or 12x"},
- { 0, NULL}
-};
-static const value_string LinkWidthActive[]= {
- {0x0001, "1x"},
- {0x0002, "4x"},
- {0x0004, "8x"},
- {0x0008, "12x"},
- { 0, NULL}
-};
-static const value_string LinkSpeedSupported[]= {
- {0x0001, "2.5 Gbps"},
- {0x0003, "2.5 or 5.0 Gbps"},
- {0x0005, "2.5 or 10.0 Gbps"},
- {0x0007, "2.5 or 5.0 or 10.0 Gbps"},
- { 0, NULL}
-};
-static const value_string PortState[]= {
- {0x0000, "No State Change"},
- {0x0001, "Down (includes failed links)"},
- {0x0002, "Initialized"},
- {0x0003, "Armed"},
- {0x0004, "Active"},
- { 0, NULL}
-};
-static const value_string PortPhysicalState[]= {
- {0x0000, "No State Change"},
- {0x0001, "Sleep"},
- {0x0002, "Polling"},
- {0x0003, "Disabled"},
- {0x0004, "PortConfigurationTraining"},
- {0x0005, "LinkUp"},
- {0x0006, "LinkErrorRecovery"},
- {0x0007, "Phy Test"},
- { 0, NULL}
-};
-static const value_string LinkDownDefaultState[]= {
- {0x0000, "No State Change"},
- {0x0001, "Sleep"},
- {0x0002, "Polling"},
- { 0, NULL}
-};
-static const value_string LinkSpeedActive[]= {
- {0x0001, "2.5 Gbps"},
- {0x0002, "5.0 Gbps"},
- {0x0004, "10.0 Gbps"},
- { 0, NULL}
-};
-static const value_string LinkSpeedEnabled[]= {
- {0x0000, "No State Change"},
- {0x0001, "2.5 Gbps"},
- {0x0003, "2.5 or 5.0 Gbps"},
- {0x0005, "2.5 or 10.0 Gbps"},
- {0x0007, "2.5 or 5.0 or 10.0 Gbps"},
- {0x000F, "Set to LinkSpeedSupported value - response contains actual LinkSpeedSupported"},
- { 0, NULL}
-};
-static const value_string NeighborMTU[]= {
- {0x0001, "256"},
- {0x0002, "512"},
- {0x0003, "1024"},
- {0x0004, "2048"},
- {0x0005, "4096"},
- { 0, NULL}
-};
-static const value_string VLCap[]= {
- {0x0001, "VL0"},
- {0x0002, "VL0, VL1"},
- {0x0003, "VL0 - VL3"},
- {0x0004, "VL0 - VL7"},
- {0x0005, "VL0 - VL14"},
- { 0, NULL}
-};
-static const value_string MTUCap[]= {
- {0x0001, "256"},
- {0x0002, "512"},
- {0x0003, "1024"},
- {0x0004, "2048"},
- {0x0005, "4096"},
- { 0, NULL}
-};
-static const value_string OperationalVLs[]= {
- {0x0000, "No State Change"},
- {0x0001, "VL0"},
- {0x0002, "VL0, VL1"},
- {0x0003, "VL0 - VL3"},
- {0x0004, "VL0 - VL7"},
- {0x0005, "VL0 - VL14"},
- { 0, NULL}
-};
-
-/* Local Route Header (LRH) */
-static int hf_infiniband_LRH = -1;
-static int hf_infiniband_virtual_lane = -1;
-static int hf_infiniband_link_version = -1;
-static int hf_infiniband_service_level = -1;
-static int hf_infiniband_reserved2 = -1;
-static int hf_infiniband_link_next_header = -1;
-static int hf_infiniband_destination_local_id = -1;
-static int hf_infiniband_reserved5 = -1;
-static int hf_infiniband_packet_length = -1;
-static int hf_infiniband_source_local_id = -1;
-/* Global Route Header (GRH) */
-static int hf_infiniband_GRH = -1;
-static int hf_infiniband_ip_version = -1;
-static int hf_infiniband_traffic_class = -1;
-static int hf_infiniband_flow_label = -1;
-static int hf_infiniband_payload_length = -1;
-static int hf_infiniband_next_header = -1;
-static int hf_infiniband_hop_limit = -1;
-static int hf_infiniband_source_gid = -1;
-static int hf_infiniband_destination_gid = -1;
-/* Base Transport Header (BTH) */
-static int hf_infiniband_BTH = -1;
-static int hf_infiniband_opcode = -1;
-static int hf_infiniband_solicited_event = -1;
-static int hf_infiniband_migreq = -1;
-static int hf_infiniband_pad_count = -1;
-static int hf_infiniband_transport_header_version = -1;
-static int hf_infiniband_partition_key = -1;
-static int hf_infiniband_reserved8 = -1;
-static int hf_infiniband_destination_qp = -1;
-static int hf_infiniband_acknowledge_request = -1;
-static int hf_infiniband_reserved7 = -1;
-static int hf_infiniband_packet_sequence_number = -1;
-/* Raw Header (RWH) */
-static int hf_infiniband_RWH = -1;
-static int hf_infiniband_reserved16_RWH = -1;
-static int hf_infiniband_etype = -1;
-/* Reliable Datagram Extended Transport Header (RDETH) */
-static int hf_infiniband_RDETH = -1;
-static int hf_infiniband_reserved8_RDETH = -1;
-static int hf_infiniband_ee_context = -1;
-/* Datagram Extended Transport Header (DETH) */
-static int hf_infiniband_DETH = -1;
-static int hf_infiniband_queue_key = -1;
-static int hf_infiniband_reserved8_DETH = -1;
-static int hf_infiniband_source_qp = -1;
-/* RDMA Extended Transport Header (RETH) */
-static int hf_infiniband_RETH = -1;
-static int hf_infiniband_virtual_address = -1;
-static int hf_infiniband_remote_key = -1;
-static int hf_infiniband_dma_length = -1;
-/* Atomic Extended Transport Header (AtomicETH) */
-static int hf_infiniband_AtomicETH = -1;
-static int hf_infiniband_virtual_address_AtomicETH = -1;
-static int hf_infiniband_remote_key_AtomicETH = -1;
-static int hf_infiniband_swap_or_add_data = -1;
-static int hf_infiniband_compare_data = -1;
-/* ACK Extended Transport Header (AETH) */
-static int hf_infiniband_AETH = -1;
-static int hf_infiniband_syndrome = -1;
-static int hf_infiniband_message_sequence_number = -1;
-/* Atomic ACK Extended Transport Header (AtomicAckETH) */
-static int hf_infiniband_AtomicAckETH = -1;
-static int hf_infiniband_original_remote_data = -1;
-/* Immediate Extended Transport Header (ImmDt) */
-static int hf_infiniband_IMMDT = -1;
-/* Invalidate Extended Transport Header (IETH) */
-static int hf_infiniband_IETH = -1;
-/* Payload */
-static int hf_infiniband_payload = -1;
-static int hf_infiniband_invariant_crc = -1;
-static int hf_infiniband_variant_crc = -1;
-/* Unknown or Vendor Specific */
-static int hf_infiniband_raw_data = -1;
-static int hf_infiniband_vendor = -1;
-/* MAD Base Header */
-static int hf_infiniband_MAD = -1;
-static int hf_infiniband_base_version = -1;
-static int hf_infiniband_mgmt_class = -1;
-static int hf_infiniband_class_version = -1;
-static int hf_infiniband_reserved1 = -1;
-static int hf_infiniband_method = -1;
-static int hf_infiniband_status = -1;
-static int hf_infiniband_class_specific = -1;
-static int hf_infiniband_transaction_id = -1;
-static int hf_infiniband_attribute_id = -1;
-static int hf_infiniband_reserved16 = -1;
-static int hf_infiniband_attribute_modifier = -1;
-static int hf_infiniband_data = -1;
-/* RMPP Header */
-static int hf_infiniband_RMPP = -1;
-static int hf_infiniband_rmpp_version = -1;
-static int hf_infiniband_rmpp_type = -1;
-static int hf_infiniband_r_resp_time = -1;
-static int hf_infiniband_rmpp_flags = -1;
-static int hf_infiniband_rmpp_status = -1;
-static int hf_infiniband_rmpp_data1 = -1;
-static int hf_infiniband_rmpp_data2 = -1;
-/* RMPP Data */
-static int hf_infiniband_RMPP_DATA = -1;
-static int hf_infiniband_segment_number = -1;
-static int hf_infiniband_payload_length32 = -1;
-static int hf_infiniband_transferred_data = -1;
-/* RMPP ACK */
-static int hf_infiniband_new_window_last = -1;
-static int hf_infiniband_reserved220 = -1;
-/* RMPP ABORT and STOP */
-static int hf_infiniband_reserved32 = -1;
-static int hf_infiniband_optional_extended_error_data = -1;
-/* SMP Data LID Routed */
-static int hf_infiniband_SMP_LID = -1;
-static int hf_infiniband_m_key = -1;
-static int hf_infiniband_smp_data = -1;
-static int hf_infiniband_reserved1024 = -1;
-static int hf_infiniband_reserved256 = -1;
-/* SMP Data Directed Route */
-static int hf_infiniband_SMP_DIRECTED = -1;
-static int hf_infiniband_smp_status = -1;
-static int hf_infiniband_hop_pointer = -1;
-static int hf_infiniband_hop_count = -1;
-static int hf_infiniband_dr_slid = -1;
-static int hf_infiniband_dr_dlid = -1;
-static int hf_infiniband_reserved28 = -1;
-static int hf_infiniband_d = -1;
-static int hf_infiniband_initial_path = -1;
-static int hf_infiniband_return_path = -1;
-/* SA MAD Header */
-static int hf_infiniband_SA = -1;
-static int hf_infiniband_sm_key = -1;
-static int hf_infiniband_attribute_offset = -1;
-static int hf_infiniband_component_mask = -1;
-static int hf_infiniband_subnet_admin_data = -1;
-
-/* Attributes
-* Additional Structures for individuala attribute decoding.
-* Since they are not headers the naming convention is slightly modified
-* Convention: hf_infiniband_[attribute name]_[field]
-* This was not entirely necessary but I felt the previous convention
-* did not provide adequate readability for the granularity of attribute/attribute fields. */
-
-/* NodeDescription */
-static int hf_infiniband_NodeDescription_NodeString = -1;
-/* NodeInfo */
-static int hf_infiniband_NodeInfo_BaseVersion = -1;
-static int hf_infiniband_NodeInfo_ClassVersion = -1;
-static int hf_infiniband_NodeInfo_NodeType = -1;
-static int hf_infiniband_NodeInfo_NumPorts = -1;
-static int hf_infiniband_NodeInfo_SystemImageGUID = -1;
-static int hf_infiniband_NodeInfo_NodeGUID = -1;
-static int hf_infiniband_NodeInfo_PortGUID = -1;
-static int hf_infiniband_NodeInfo_PartitionCap = -1;
-static int hf_infiniband_NodeInfo_DeviceID = -1;
-static int hf_infiniband_NodeInfo_Revision = -1;
-static int hf_infiniband_NodeInfo_LocalPortNum = -1;
-static int hf_infiniband_NodeInfo_VendorID = -1;
-/* SwitchInfo */
-static int hf_infiniband_SwitchInfo_LinearFDBCap = -1;
-static int hf_infiniband_SwitchInfo_RandomFDBCap = -1;
-static int hf_infiniband_SwitchInfo_MulticastFDBCap = -1;
-static int hf_infiniband_SwitchInfo_LinearFDBTop = -1;
-static int hf_infiniband_SwitchInfo_DefaultPort = -1;
-static int hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort = -1;
-static int hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort = -1;
-static int hf_infiniband_SwitchInfo_LifeTimeValue = -1;
-static int hf_infiniband_SwitchInfo_PortStateChange = -1;
-static int hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming = -1;
-static int hf_infiniband_SwitchInfo_LIDsPerPort = -1;
-static int hf_infiniband_SwitchInfo_PartitionEnforcementCap = -1;
-static int hf_infiniband_SwitchInfo_InboundEnforcementCap = -1;
-static int hf_infiniband_SwitchInfo_OutboundEnforcementCap = -1;
-static int hf_infiniband_SwitchInfo_FilterRawInboundCap = -1;
-static int hf_infiniband_SwitchInfo_FilterRawOutboundCap = -1;
-static int hf_infiniband_SwitchInfo_EnhancedPortZero = -1;
-/* GUIDInfo */
-static int hf_infiniband_GUIDInfo_GUIDBlock = -1;
-static int hf_infiniband_GUIDInfo_GUID = -1;
-/* PortInfo */
-static int hf_infiniband_PortInfo_GidPrefix = -1;
-static int hf_infiniband_PortInfo_LID = -1;
-static int hf_infiniband_PortInfo_MasterSMLID = -1;
-static int hf_infiniband_PortInfo_CapabilityMask = -1;
-
-/* Capability Mask Flags */
-static int hf_infiniband_PortInfo_CapabilityMask_SM;
-static int hf_infiniband_PortInfo_CapabilityMask_NoticeSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_TrapSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_SMdisabled = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_ReinitSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported = -1;
-static int hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported = -1;
-/* End Capability Mask Flags */
-
-
-static int hf_infiniband_PortInfo_DiagCode = -1;
-static int hf_infiniband_PortInfo_M_KeyLeasePeriod = -1;
-static int hf_infiniband_PortInfo_LocalPortNum = -1;
-static int hf_infiniband_PortInfo_LinkWidthEnabled = -1;
-static int hf_infiniband_PortInfo_LinkWidthSupported = -1;
-static int hf_infiniband_PortInfo_LinkWidthActive = -1;
-static int hf_infiniband_PortInfo_LinkSpeedSupported = -1;
-static int hf_infiniband_PortInfo_PortState = -1;
-static int hf_infiniband_PortInfo_PortPhysicalState = -1;
-static int hf_infiniband_PortInfo_LinkDownDefaultState = -1;
-static int hf_infiniband_PortInfo_M_KeyProtectBits = -1;
-static int hf_infiniband_PortInfo_LMC = -1;
-static int hf_infiniband_PortInfo_LinkSpeedActive = -1;
-static int hf_infiniband_PortInfo_LinkSpeedEnabled = -1;
-static int hf_infiniband_PortInfo_NeighborMTU = -1;
-static int hf_infiniband_PortInfo_MasterSMSL = -1;
-static int hf_infiniband_PortInfo_VLCap = -1;
-static int hf_infiniband_PortInfo_M_Key = -1;
-static int hf_infiniband_PortInfo_InitType = -1;
-static int hf_infiniband_PortInfo_VLHighLimit = -1;
-static int hf_infiniband_PortInfo_VLArbitrationHighCap = -1;
-static int hf_infiniband_PortInfo_VLArbitrationLowCap = -1;
-static int hf_infiniband_PortInfo_InitTypeReply = -1;
-static int hf_infiniband_PortInfo_MTUCap = -1;
-static int hf_infiniband_PortInfo_VLStallCount = -1;
-static int hf_infiniband_PortInfo_HOQLife = -1;
-static int hf_infiniband_PortInfo_OperationalVLs = -1;
-static int hf_infiniband_PortInfo_PartitionEnforcementInbound = -1;
-static int hf_infiniband_PortInfo_PartitionEnforcementOutbound = -1;
-static int hf_infiniband_PortInfo_FilterRawInbound = -1;
-static int hf_infiniband_PortInfo_FilterRawOutbound = -1;
-static int hf_infiniband_PortInfo_M_KeyViolations = -1;
-static int hf_infiniband_PortInfo_P_KeyViolations = -1;
-static int hf_infiniband_PortInfo_Q_KeyViolations = -1;
-static int hf_infiniband_PortInfo_GUIDCap = -1;
-static int hf_infiniband_PortInfo_ClientReregister = -1;
-static int hf_infiniband_PortInfo_SubnetTimeOut = -1;
-static int hf_infiniband_PortInfo_RespTimeValue = -1;
-static int hf_infiniband_PortInfo_LocalPhyErrors = -1;
-static int hf_infiniband_PortInfo_OverrunErrors = -1;
-static int hf_infiniband_PortInfo_MaxCreditHint = -1;
-static int hf_infiniband_PortInfo_LinkRoundTripLatency = -1;
-
-/* P_KeyTable */
-static int hf_infiniband_P_KeyTable_P_KeyTableBlock = -1;
-static int hf_infiniband_P_KeyTable_MembershipType = -1;
-static int hf_infiniband_P_KeyTable_P_KeyBase = -1;
-
-/* SLtoVLMappingTable */
-static int hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits = -1;
-static int hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits = -1;
-
-/* VLArbitrationTable */
-static int hf_infiniband_VLArbitrationTable_VLWeightPairs = -1;
-static int hf_infiniband_VLArbitrationTable_VL = -1;
-static int hf_infiniband_VLArbitrationTable_Weight = -1;
-
-/* LinearForwardingTable */
-static int hf_infiniband_LinearForwardingTable_LinearForwardingTableBlock = -1;
-static int hf_infiniband_LinearForwardingTable_Port = -1;
-
-/* RandomForwardingTable */
-static int hf_infiniband_RandomForwardingTable_RandomForwardingTableBlock = -1;
-static int hf_infiniband_RandomForwardingTable_LID = -1;
-static int hf_infiniband_RandomForwardingTable_Valid = -1;
-static int hf_infiniband_RandomForwardingTable_LMC = -1;
-static int hf_infiniband_RandomForwardingTable_Port = -1;
-
-/* MulticastForwardingTable */
-static int hf_infiniband_MulticastForwardingTable_MulticastForwardingTableBlock = -1;
-static int hf_infiniband_MulticastForwardingTable_PortMask = -1;
-
-/* SMInfo */
-static int hf_infiniband_SMInfo_GUID = -1;
-static int hf_infiniband_SMInfo_SM_Key = -1;
-static int hf_infiniband_SMInfo_ActCount = -1;
-static int hf_infiniband_SMInfo_Priority = -1;
-static int hf_infiniband_SMInfo_SMState = -1;
-
-/* VendorDiag */
-static int hf_infiniband_VendorDiag_NextIndex = -1;
-static int hf_infiniband_VendorDiag_DiagData = -1;
-
-/* LedInfo */
-static int hf_infiniband_LedInfo_LedMask = -1;
-
-/* LinkSpeedWidthPairsTable */
-static int hf_infiniband_LinkSpeedWidthPairsTable_NumTables = -1;
-static int hf_infiniband_LinkSpeedWidthPairsTable_PortMask = -1;
-static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive = -1;
-static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive = -1;
-static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen = -1;
-
-/* Attributes for Subnet Administration.
-* Mostly we have "Records" here which are just structures of SM attributes.
-* There are some unique attributes though that we will want to have a structure for. */
-
-/* NodeRecord */
-/* PortInfoRecord */
-/* SLtoVLMappingTableRecord */
-/* SwitchInfoRecord */
-/* LinearForwardingTableRecord */
-/* RandomForwardingTableRecord */
-/* MulticastForwardingTableRecord */
-/* VLArbitrationTableRecord */
-
-static int hf_infiniband_SA_LID = -1;
-static int hf_infiniband_SA_EndportLID = -1;
-static int hf_infiniband_SA_PortNum = -1;
-static int hf_infiniband_SA_InputPortNum = -1;
-static int hf_infiniband_SA_OutputPortNum = -1;
-static int hf_infiniband_SA_BlockNum_EightBit = -1;
-static int hf_infiniband_SA_BlockNum_NineBit = -1;
-static int hf_infiniband_SA_BlockNum_SixteenBit = -1;
-static int hf_infiniband_SA_Position = -1;
-static int hf_infiniband_SA_Index = -1;
-
-/* InformInfoRecord */
-static int hf_infiniband_InformInfoRecord_SubscriberGID = -1;
-static int hf_infiniband_InformInfoRecord_Enum = -1;
-
-/* InformInfo */
-static int hf_infiniband_InformInfo_GID = -1;
-static int hf_infiniband_InformInfo_LIDRangeBegin = -1;
-static int hf_infiniband_InformInfo_LIDRangeEnd = -1;
-static int hf_infiniband_InformInfo_IsGeneric = -1;
-static int hf_infiniband_InformInfo_Subscribe = -1;
-static int hf_infiniband_InformInfo_Type = -1;
-static int hf_infiniband_InformInfo_TrapNumberDeviceID = -1;
-static int hf_infiniband_InformInfo_QPN = -1;
-static int hf_infiniband_InformInfo_RespTimeValue = -1;
-static int hf_infiniband_InformInfo_ProducerTypeVendorID = -1;
-
-/* LinkRecord */
-static int hf_infiniband_LinkRecord_FromLID = -1;
-static int hf_infiniband_LinkRecord_FromPort = -1;
-static int hf_infiniband_LinkRecord_ToPort = -1;
-static int hf_infiniband_LinkRecord_ToLID = -1;
-
-/* ServiceRecord */
-static int hf_infiniband_ServiceRecord_ServiceID = -1;
-static int hf_infiniband_ServiceRecord_ServiceGID = -1;
-static int hf_infiniband_ServiceRecord_ServiceP_Key = -1;
-static int hf_infiniband_ServiceRecord_ServiceLease = -1;
-static int hf_infiniband_ServiceRecord_ServiceKey = -1;
-static int hf_infiniband_ServiceRecord_ServiceName = -1;
-static int hf_infiniband_ServiceRecord_ServiceData = -1;
-
-/* ServiceAssociationRecord */
-static int hf_infiniband_ServiceAssociationRecord_ServiceKey = -1;
-static int hf_infiniband_ServiceAssociationRecord_ServiceName = -1;
-
-/* PathRecord */
-static int hf_infiniband_PathRecord_DGID = -1;
-static int hf_infiniband_PathRecord_SGID = -1;
-static int hf_infiniband_PathRecord_DLID = -1;
-static int hf_infiniband_PathRecord_SLID = -1;
-static int hf_infiniband_PathRecord_RawTraffic = -1;
-static int hf_infiniband_PathRecord_FlowLabel = -1;
-static int hf_infiniband_PathRecord_HopLimit = -1;
-static int hf_infiniband_PathRecord_TClass = -1;
-static int hf_infiniband_PathRecord_Reversible = -1;
-static int hf_infiniband_PathRecord_NumbPath = -1;
-static int hf_infiniband_PathRecord_P_Key = -1;
-static int hf_infiniband_PathRecord_SL = -1;
-static int hf_infiniband_PathRecord_MTUSelector = -1;
-static int hf_infiniband_PathRecord_MTU = -1;
-static int hf_infiniband_PathRecord_RateSelector = -1;
-static int hf_infiniband_PathRecord_Rate = -1;
-static int hf_infiniband_PathRecord_PacketLifeTimeSelector = -1;
-static int hf_infiniband_PathRecord_PacketLifeTime = -1;
-static int hf_infiniband_PathRecord_Preference = -1;
-
-/* MCMemberRecord */
-static int hf_infiniband_MCMemberRecord_MGID = -1;
-static int hf_infiniband_MCMemberRecord_PortGID = -1;
-static int hf_infiniband_MCMemberRecord_Q_Key = -1;
-static int hf_infiniband_MCMemberRecord_MLID = -1;
-static int hf_infiniband_MCMemberRecord_MTUSelector = -1;
-static int hf_infiniband_MCMemberRecord_MTU = -1;
-static int hf_infiniband_MCMemberRecord_TClass = -1;
-static int hf_infiniband_MCMemberRecord_P_Key = -1;
-static int hf_infiniband_MCMemberRecord_RateSelector = -1;
-static int hf_infiniband_MCMemberRecord_Rate = -1;
-static int hf_infiniband_MCMemberRecord_PacketLifeTimeSelector = -1;
-static int hf_infiniband_MCMemberRecord_PacketLifeTime = -1;
-static int hf_infiniband_MCMemberRecord_SL = -1;
-static int hf_infiniband_MCMemberRecord_FlowLabel = -1;
-static int hf_infiniband_MCMemberRecord_HopLimit = -1;
-static int hf_infiniband_MCMemberRecord_Scope = -1;
-static int hf_infiniband_MCMemberRecord_JoinState = -1;
-static int hf_infiniband_MCMemberRecord_ProxyJoin = -1;
-
-/* TraceRecord */
-static int hf_infiniband_TraceRecord_GIDPrefix = -1;
-static int hf_infiniband_TraceRecord_IDGeneration = -1;
-static int hf_infiniband_TraceRecord_NodeType = -1;
-static int hf_infiniband_TraceRecord_NodeID = -1;
-static int hf_infiniband_TraceRecord_ChassisID = -1;
-static int hf_infiniband_TraceRecord_EntryPortID = -1;
-static int hf_infiniband_TraceRecord_ExitPortID = -1;
-static int hf_infiniband_TraceRecord_EntryPort = -1;
-static int hf_infiniband_TraceRecord_ExitPort = -1;
-
-/* MultiPathRecord */
-static int hf_infiniband_MultiPathRecord_RawTraffic = -1;
-static int hf_infiniband_MultiPathRecord_FlowLabel = -1;
-static int hf_infiniband_MultiPathRecord_HopLimit = -1;
-static int hf_infiniband_MultiPathRecord_TClass = -1;
-static int hf_infiniband_MultiPathRecord_Reversible = -1;
-static int hf_infiniband_MultiPathRecord_NumbPath = -1;
-static int hf_infiniband_MultiPathRecord_P_Key = -1;
-static int hf_infiniband_MultiPathRecord_SL = -1;
-static int hf_infiniband_MultiPathRecord_MTUSelector = -1;
-static int hf_infiniband_MultiPathRecord_MTU = -1;
-static int hf_infiniband_MultiPathRecord_RateSelector = -1;
-static int hf_infiniband_MultiPathRecord_Rate = -1;
-static int hf_infiniband_MultiPathRecord_PacketLifeTimeSelector = -1;
-static int hf_infiniband_MultiPathRecord_PacketLifeTime = -1;
-static int hf_infiniband_MultiPathRecord_IndependenceSelector = -1;
-static int hf_infiniband_MultiPathRecord_GIDScope = -1;
-static int hf_infiniband_MultiPathRecord_SGIDCount = -1;
-static int hf_infiniband_MultiPathRecord_DGIDCount = -1;
-static int hf_infiniband_MultiPathRecord_SDGID = -1;
-
-/* Notice */
-static int hf_infiniband_Notice_IsGeneric = -1;
-static int hf_infiniband_Notice_Type = -1;
-static int hf_infiniband_Notice_ProducerTypeVendorID = -1;
-static int hf_infiniband_Notice_TrapNumberDeviceID = -1;
-static int hf_infiniband_Notice_IssuerLID = -1;
-static int hf_infiniband_Notice_NoticeToggle = -1;
-static int hf_infiniband_Notice_NoticeCount = -1;
-static int hf_infiniband_Notice_DataDetails = -1;
-static int hf_infiniband_Notice_IssuerGID = -1;
-static int hf_infiniband_Notice_ClassTrapSpecificData = -1;
-
-/* Notice DataDetails and ClassTrapSpecific Data for certain traps
-* Note that traps reuse many fields, so they are only declared once under the first trap that they appear.
-* There is no need to redeclare them for specific Traps (as with other SA Attributes) because they are uniform between Traps. */
-
-/* Parse DataDetails for a given Trap */
-static void parse_NoticeDataDetails(proto_tree*, tvbuff_t*, gint *offset, guint16 trapNumber);
-
-/* Traps 64,65,66,67 */
-static int hf_infiniband_Trap_GIDADDR = -1;
-
-/* Traps 68,69 */
-/* DataDetails */
-static int hf_infiniband_Trap_COMP_MASK = -1;
-static int hf_infiniband_Trap_WAIT_FOR_REPATH = -1;
-/* ClassTrapSpecificData */
-static int hf_infiniband_Trap_PATH_REC = -1;
-
-/* Trap 128 */
-static int hf_infiniband_Trap_LIDADDR = -1;
-
-/* Trap 129, 130, 131 */
-static int hf_infiniband_Trap_PORTNO = -1;
-
-/* Trap 144 */
-static int hf_infiniband_Trap_OtherLocalChanges = -1;
-static int hf_infiniband_Trap_CAPABILITYMASK = -1;
-static int hf_infiniband_Trap_LinkSpeecEnabledChange = -1;
-static int hf_infiniband_Trap_LinkWidthEnabledChange = -1;
-static int hf_infiniband_Trap_NodeDescriptionChange = -1;
-
-/* Trap 145 */
-static int hf_infiniband_Trap_SYSTEMIMAGEGUID = -1;
-
-/* Trap 256 */
-static int hf_infiniband_Trap_DRSLID = -1;
-static int hf_infiniband_Trap_METHOD = -1;
-static int hf_infiniband_Trap_ATTRIBUTEID = -1;
-static int hf_infiniband_Trap_ATTRIBUTEMODIFIER = -1;
-static int hf_infiniband_Trap_MKEY = -1;
-static int hf_infiniband_Trap_DRNotice = -1;
-static int hf_infiniband_Trap_DRPathTruncated = -1;
-static int hf_infiniband_Trap_DRHopCount = -1;
-static int hf_infiniband_Trap_DRNoticeReturnPath = -1;
-
-/* Trap 257, 258 */
-static int hf_infiniband_Trap_LIDADDR1 = -1;
-static int hf_infiniband_Trap_LIDADDR2 = -1;
-static int hf_infiniband_Trap_KEY = -1;
-static int hf_infiniband_Trap_SL = -1;
-static int hf_infiniband_Trap_QP1 = -1;
-static int hf_infiniband_Trap_QP2 = -1;
-static int hf_infiniband_Trap_GIDADDR1 = -1;
-static int hf_infiniband_Trap_GIDADDR2 = -1;
-
-/* Trap 259 */
-static int hf_infiniband_Trap_DataValid = -1;
-static int hf_infiniband_Trap_PKEY = -1;
-static int hf_infiniband_Trap_SWLIDADDR = -1;
-
-/* Trap Type/Descriptions for dissection */
-static const value_string Trap_Description[]= {
- { 64, " (Informational) <GIDADDR> is now in service"},
- { 65, " (Informational) <GIDADDR> is out of service"},
- { 66, " (Informational) New Multicast Group with multicast address <GIDADDR> is now created"},
- { 67, " (Informational) Multicast Group with multicast address <GIDADDR> is now deleted"},
- { 68, " (Informational) Paths indicated by <PATH_REC> and <COMP_MASK> are no longer valid"},
- { 69, " (Informational) Paths indicated by <PATH_REC> and <COMP_MASK> have been recomputed"},
- { 128, " (Urgent) Link State of at least one port of switch at <LIDADDR> has changed"},
- { 129, " (Urgent) Local Link Integrity threshold reached at <LIDADDR><PORTNO>"},
- { 130, " (Urgent) Excessive Buffer OVerrun threshold reached at <LIDADDR><PORTNO>"},
- { 131, " (Urgent) Flow Control Update watchdog timer expired at <LIDADDR><PORTNO>"},
- { 144, " (Informational) CapMask, NodeDesc, LinkWidthEnabled or LinkSpeedEnabled at <LIDADDR> has been modified"},
- { 145, " (Informational) SystemImageGUID at <LIDADDR> has been modified. New value is <SYSTEMIMAGEGUID>"},
- { 256, " (Security) Bad M_Key, <M_KEY> from <LIDADDR> attempted <METHOD> with <ATTRIBUTEID> and <ATTRIBUTEMODIFIER>"},
- { 257, " (Security) Bad P_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL>"},
- { 258, " (Security) Bad Q_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL>"},
- { 259, " (Security) Bad P_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL> at switch <LIDADDR><PORTNO>"},
- { 0, NULL}
-};
-
-
-
-
-/* MAD Management Classes
-* Classes from the Common MAD Header
-*
-* Management Class Name Class Description
-* ------------------------------------------------------------------------------------------------------------ */
-#define SUBN_LID_ROUTED 0x01 /* Subnet Management LID Route */
-#define SUBN_DIRECTED_ROUTE 0x81 /* Subnet Management Directed Route */
-#define SUBNADMN 0x03 /* Subnet Administration */
-#define PERF 0x04 /* Performance Management */
-#define BM 0x05 /* Baseboard Management (Tunneling of IB-ML commands through the IBA subnet) */
-#define DEV_MGT 0x06 /* Device Management */
-#define COM_MGT 0x07 /* Communications Management */
-#define SNMP 0x08 /* SNMP Tunneling (tunneling of the SNMP protocol through the IBA fabric) */
-#define VENDOR_1_START 0x09 /* Start of first Vendor Specific Range */
-#define VENDOR_1_END 0x0F /* End of first Vendor Specific Range */
-#define VENDOR_2_START 0x30 /* Start of second Vendor Specific Range */
-#define VENDOR_2_END 0x4F /* End of the second Vendor Specific Range */
-#define APPLICATION_START 0x10 /* Start of Application Specific Range */
-#define APPLICATION_END 0x2F /* End of Application Specific Range */
-
-/* Link Next Header Values */
-#define IBA_GLOBAL 3
-#define IBA_LOCAL 2
-#define IP_NON_IBA 1
-#define RAW 0
-
-/* OpCodeValues
-* Code Bits [7-5] Connection Type
-* [4-0] Message Type
-
-* Reliable Connection (RC)
-* [7-5] = 000 */
-#define RC_SEND_FIRST 0 /*0x00000000 */
-#define RC_SEND_MIDDLE 1 /*0x00000001 */
-#define RC_SEND_LAST 2 /*0x00000010 */
-#define RC_SEND_LAST_IMM 3 /*0x00000011 */
-#define RC_SEND_ONLY 4 /*0x00000100 */
-#define RC_SEND_ONLY_IMM 5 /*0x00000101 */
-#define RC_RDMA_WRITE_FIRST 6 /*0x00000110 */
-#define RC_RDMA_WRITE_MIDDLE 7 /*0x00000111 */
-#define RC_RDMA_WRITE_LAST 8 /*0x00001000 */
-#define RC_RDMA_WRITE_LAST_IMM 9 /*0x00001001 */
-#define RC_RDMA_WRITE_ONLY 10 /*0x00001010 */
-#define RC_RDMA_WRITE_ONLY_IMM 11 /*0x00001011 */
-#define RC_RDMA_READ_REQUEST 12 /*0x00001100 */
-#define RC_RDMA_READ_RESPONSE_FIRST 13 /*0x00001101 */
-#define RC_RDMA_READ_RESPONSE_MIDDLE 14 /*0x00001110 */
-#define RC_RDMA_READ_RESPONSE_LAST 15 /*0x00001111 */
-#define RC_RDMA_READ_RESPONSE_ONLY 16 /*0x00010000 */
-#define RC_ACKNOWLEDGE 17 /*0x00010001 */
-#define RC_ATOMIC_ACKNOWLEDGE 18 /*0x00010010 */
-#define RC_CMP_SWAP 19 /*0x00010011 */
-#define RC_FETCH_ADD 20 /*0x00010100 */
-#define RC_SEND_LAST_INVAL 22 /*0x00010110 */
-#define RC_SEND_ONLY_INVAL 23 /*0x00010111 */
-
-/* Reliable Datagram (RD)
-* [7-5] = 010 */
-#define RD_SEND_FIRST 64 /*0x01000000 */
-#define RD_SEND_MIDDLE 65 /*0x01000001 */
-#define RD_SEND_LAST 66 /*0x01000010 */
-#define RD_SEND_LAST_IMM 67 /*0x01000011 */
-#define RD_SEND_ONLY 68 /*0x01000100 */
-#define RD_SEND_ONLY_IMM 69 /*0x01000101 */
-#define RD_RDMA_WRITE_FIRST 70 /*0x01000110 */
-#define RD_RDMA_WRITE_MIDDLE 71 /*0x01000111 */
-#define RD_RDMA_WRITE_LAST 72 /*0x01001000 */
-#define RD_RDMA_WRITE_LAST_IMM 73 /*0x01001001 */
-#define RD_RDMA_WRITE_ONLY 74 /*0x01001010 */
-#define RD_RDMA_WRITE_ONLY_IMM 75 /*0x01001011 */
-#define RD_RDMA_READ_REQUEST 76 /*0x01001100 */
-#define RD_RDMA_READ_RESPONSE_FIRST 77 /*0x01001101 */
-#define RD_RDMA_READ_RESPONSE_MIDDLE 78 /*0x01001110 */
-#define RD_RDMA_READ_RESPONSE_LAST 79 /*0x01001111 */
-#define RD_RDMA_READ_RESPONSE_ONLY 80 /*0x01010000 */
-#define RD_ACKNOWLEDGE 81 /*0x01010001 */
-#define RD_ATOMIC_ACKNOWLEDGE 82 /*0x01010010 */
-#define RD_CMP_SWAP 83 /*0x01010011 */
-#define RD_FETCH_ADD 84 /*0x01010100 */
-#define RD_RESYNC 85 /*0x01010101 */
-
-/* Unreliable Datagram (UD)
-* [7-5] = 011 */
-#define UD_SEND_ONLY 100 /*0x01100100 */
-#define UD_SEND_ONLY_IMM 101 /*0x01100101 */
-
-/* Unreliable Connection (UC)
-* [7-5] = 001 */
-#define UC_SEND_FIRST 32 /*0x00100000 */
-#define UC_SEND_MIDDLE 33 /*0x00100001 */
-#define UC_SEND_LAST 34 /*0x00100010 */
-#define UC_SEND_LAST_IMM 35 /*0x00100011 */
-#define UC_SEND_ONLY 36 /*0x00100100 */
-#define UC_SEND_ONLY_IMM 37 /*0x00100101 */
-#define UC_RDMA_WRITE_FIRST 38 /*0x00100110 */
-#define UC_RDMA_WRITE_MIDDLE 39 /*0x00100111 */
-#define UC_RDMA_WRITE_LAST 40 /*0x00101000 */
-#define UC_RDMA_WRITE_LAST_IMM 41 /*0x00101001 */
-#define UC_RDMA_WRITE_ONLY 42 /*0x00101010 */
-#define UC_RDMA_WRITE_ONLY_IMM 43 /*0x00101011 */
-
-static value_string OpCodeMap[] =
-{
- { RC_SEND_FIRST, "RC Send First " },
- { RC_SEND_MIDDLE, "RC Send Middle "},
- { RC_SEND_LAST, "RC Send Last " },
- { RC_SEND_LAST_IMM, "RC Send Last Immediate "},
- { RC_SEND_ONLY, "RC Send Only "},
- { RC_SEND_ONLY_IMM, "RC Send Only Immediate "},
- { RC_RDMA_WRITE_FIRST, "RC RDMA Write First " },
- { RC_RDMA_WRITE_MIDDLE, "RC RDMA Write Middle "},
- { RC_RDMA_WRITE_LAST, "RC RDMA Write Last "},
- { RC_RDMA_WRITE_LAST_IMM, "RC RDMA Write Last Immediate " },
- { RC_RDMA_WRITE_ONLY, "RC RDMA Write Only " },
- { RC_RDMA_WRITE_ONLY_IMM, "RC RDMA Write Only Immediate "},
- { RC_RDMA_READ_REQUEST, "RC RDMA Read Request " },
- { RC_RDMA_READ_RESPONSE_FIRST, "RC RDMA Read Response First " },
- { RC_RDMA_READ_RESPONSE_MIDDLE, "RC RDMA Read Response Middle "},
- { RC_RDMA_READ_RESPONSE_LAST, "RC RDMA Read Response Last " },
- { RC_RDMA_READ_RESPONSE_ONLY, "RC RDMA Read Response Only "},
- { RC_ACKNOWLEDGE, "RC Acknowledge " },
- { RC_ATOMIC_ACKNOWLEDGE, "RC Atomic Acknowledge " },
- { RC_CMP_SWAP, "RC Compare Swap " },
- { RC_FETCH_ADD, "RC Fetch Add "},
- { RC_SEND_LAST_INVAL, "RC Send Last Invalidate "},
- { RC_SEND_ONLY_INVAL, "RC Send Only Invalidate " },
-
-
- { RD_SEND_FIRST, "RD Send First "},
- { RD_SEND_MIDDLE,"RD Send Middle " },
- { RD_SEND_LAST, "RD Send Last "},
- { RD_SEND_LAST_IMM, "RD Last Immediate " },
- { RD_SEND_ONLY,"RD Send Only "},
- { RD_SEND_ONLY_IMM,"RD Send Only Immediate "},
- { RD_RDMA_WRITE_FIRST,"RD RDMA Write First "},
- { RD_RDMA_WRITE_MIDDLE, "RD RDMA Write Middle "},
- { RD_RDMA_WRITE_LAST,"RD RDMA Write Last "},
- { RD_RDMA_WRITE_LAST_IMM,"RD RDMA Write Last Immediate "},
- { RD_RDMA_WRITE_ONLY,"RD RDMA Write Only "},
- { RD_RDMA_WRITE_ONLY_IMM,"RD RDMA Write Only Immediate "},
- { RD_RDMA_READ_REQUEST,"RD RDMA Read Request "},
- { RD_RDMA_READ_RESPONSE_FIRST,"RD RDMA Read Response First "},
- { RD_RDMA_READ_RESPONSE_MIDDLE,"RD RDMA Read Response Middle "},
- { RD_RDMA_READ_RESPONSE_LAST,"RD RDMA Read Response Last "},
- { RD_RDMA_READ_RESPONSE_ONLY,"RD RDMA Read Response Only "},
- { RD_ACKNOWLEDGE,"RD Acknowledge "},
- { RD_ATOMIC_ACKNOWLEDGE,"RD Atomic Acknowledge "},
- { RD_CMP_SWAP,"RD Compare Swap "},
- { RD_FETCH_ADD, "RD Fetch Add "},
- { RD_RESYNC,"RD RESYNC "},
-
-
- { UD_SEND_ONLY, "UD Send Only "},
- { UD_SEND_ONLY_IMM, "UD Send Only Immediate "},
-
-
- { UC_SEND_FIRST,"UC Send First "},
- { UC_SEND_MIDDLE,"UC Send Middle "},
- { UC_SEND_LAST,"UC Send Last "},
- { UC_SEND_LAST_IMM,"UC Send Last Immediate "},
- { UC_SEND_ONLY,"UC Send Only "},
- { UC_SEND_ONLY_IMM,"UC Send Only Immediate "},
- { UC_RDMA_WRITE_FIRST,"UC RDMA Write First"},
- { UC_RDMA_WRITE_MIDDLE,"Unreliable Connection RDMA Write Middle "},
- { UC_RDMA_WRITE_LAST,"UC RDMA Write Last "},
- { UC_RDMA_WRITE_LAST_IMM,"UC RDMA Write Last Immediate "},
- { UC_RDMA_WRITE_ONLY,"UC RDMA Write Only "},
- { UC_RDMA_WRITE_ONLY_IMM,"UC RDMA Write Only Immediate "},
- { 0, NULL}
-
-};
-
-
-
-/* Header Ordering Based on OPCODES
-* These are simply an enumeration of the possible header combinations defined by the IB Spec.
-* These enumerations
-* #DEFINE [HEADER_ORDER] [ENUM]
-* __________________________________ */
-#define RDETH_DETH_PAYLD 0
-/* __________________________________ */
-#define RDETH_DETH_RETH_PAYLD 1
-/* __________________________________ */
-#define RDETH_DETH_IMMDT_PAYLD 2
-/* __________________________________ */
-#define RDETH_DETH_RETH_IMMDT_PAYLD 3
-/* __________________________________ */
-#define RDETH_DETH_RETH 4
-/* __________________________________ */
-#define RDETH_AETH_PAYLD 5
-/* __________________________________ */
-#define RDETH_PAYLD 6
-/* __________________________________ */
-#define RDETH_AETH 7
-/* __________________________________ */
-#define RDETH_AETH_ATOMICACKETH 8
-/* __________________________________ */
-#define RDETH_DETH_ATOMICETH 9
-/* ___________________________________ */
-#define RDETH_DETH 10
-/* ___________________________________ */
-#define DETH_PAYLD 11
-/* ___________________________________ */
-#define DETH_IMMDT_PAYLD 12
-/* ___________________________________ */
-#define PAYLD 13
-/* ___________________________________ */
-#define IMMDT_PAYLD 14
-/* ___________________________________ */
-#define RETH_PAYLD 15
-/* ___________________________________ */
-#define RETH_IMMDT_PAYLD 16
-/* ___________________________________ */
-#define RETH 17
-/* ___________________________________ */
-#define AETH_PAYLD 18
-/* ___________________________________ */
-#define AETH 19
-/* ___________________________________ */
-#define AETH_ATOMICACKETH 20
-/* ___________________________________ */
-#define ATOMICETH 21
-/* ___________________________________ */
-#define IETH_PAYLD 22
-/* ___________________________________ */
-
-
-/* Array of all availavle OpCodes to make matching a bit easier.
-* The OpCodes dictate the header sequence following in the packet.
-* These arrays tell the dissector which headers must be decoded for the given OpCode. */
-static guint32 opCode_RDETH_DETH_ATOMICETH[] = {
- RD_CMP_SWAP,
- RD_FETCH_ADD
-};
-static guint32 opCode_IETH_PAYLD[] = {
- RC_SEND_LAST_INVAL,
- RC_SEND_ONLY_INVAL
-};
-static guint32 opCode_ATOMICETH[] = {
- RC_CMP_SWAP,
- RC_FETCH_ADD
-};
-static guint32 opCode_RDETH_DETH_RETH_PAYLD[] = {
- RD_RDMA_WRITE_FIRST,
- RD_RDMA_WRITE_ONLY
-};
-static guint32 opCode_RETH_IMMDT_PAYLD[] = {
- RC_RDMA_WRITE_ONLY_IMM,
- UC_RDMA_WRITE_ONLY_IMM
-};
-static guint32 opCode_RDETH_DETH_IMMDT_PAYLD[] = {
- RD_SEND_LAST_IMM,
- RD_SEND_ONLY_IMM,
- RD_RDMA_WRITE_LAST_IMM
-};
-
-static guint32 opCode_RDETH_AETH_PAYLD[] = {
- RD_RDMA_READ_RESPONSE_FIRST,
- RD_RDMA_READ_RESPONSE_LAST,
- RD_RDMA_READ_RESPONSE_ONLY
-};
-static guint32 opCode_AETH_PAYLD[] = {
- RC_RDMA_READ_RESPONSE_FIRST,
- RC_RDMA_READ_RESPONSE_LAST,
- RC_RDMA_READ_RESPONSE_ONLY
-};
-static guint32 opCode_RETH_PAYLD[] = {
- RC_RDMA_WRITE_FIRST,
- RC_RDMA_WRITE_ONLY,
- UC_RDMA_WRITE_FIRST,
- UC_RDMA_WRITE_ONLY
-};
-
-static guint32 opCode_RDETH_DETH_PAYLD[] = {
- RD_SEND_FIRST,
- RD_SEND_MIDDLE,
- RD_SEND_LAST,
- RD_SEND_ONLY,
- RD_RDMA_WRITE_MIDDLE,
- RD_RDMA_WRITE_LAST
-};
-
-static guint32 opCode_IMMDT_PAYLD[] = {
- RC_SEND_LAST_IMM,
- RC_SEND_ONLY_IMM,
- RC_RDMA_WRITE_LAST_IMM,
- UC_SEND_LAST_IMM,
- UC_SEND_ONLY_IMM,
- UC_RDMA_WRITE_LAST_IMM
-};
-
-static guint32 opCode_PAYLD[] = {
- RC_SEND_FIRST,
- RC_SEND_MIDDLE,
- RC_SEND_LAST,
- RC_SEND_ONLY,
- RC_RDMA_WRITE_MIDDLE,
- RC_RDMA_WRITE_LAST,
- RC_RDMA_READ_RESPONSE_MIDDLE,
- UC_SEND_FIRST,
- UC_SEND_MIDDLE,
- UC_SEND_LAST,
- UC_SEND_ONLY,
- UC_RDMA_WRITE_MIDDLE,
- UC_RDMA_WRITE_LAST
-};
-
-/* It is not necessary to create arrays for these OpCodes since they indicate only one further header.
-* We can just decode it directly
-
-* static guint32 opCode_DETH_IMMDT_PAYLD[] = {
-* UD_SEND_ONLY_IMM
-* };
-* static guint32 opCode_DETH_PAYLD[] = {
-* UD_SEND_ONLY
-* };
-* static guint32 opCode_RDETH_DETH[] = {
-* RD_RESYNC
-* };
-* static guint32 opCode_RDETH_DETH_RETH[] = {
-* RD_RDMA_READ_REQUEST
-* };
-* static guint32 opCode_RDETH_DETH_RETH_IMMDT_PAYLD[] = {
-* RD_RDMA_WRITE_ONLY_IMM
-* };
-* static guint32 opCode_RDETH_AETH_ATOMICACKETH[] = {
-* RD_ATOMIC_ACKNOWLEDGE
-* };
-* static guint32 opCode_RDETH_AETH[] = {
-* RD_ACKNOWLEDGE
-* };
-* static guint32 opCode_RDETH_PAYLD[] = {
-* RD_RDMA_READ_RESPONSE_MIDDLE
-* };
-* static guint32 opCode_AETH_ATOMICACKETH[] = {
-* RC_ATOMIC_ACKNOWLEDGE
-* };
-* static guint32 opCode_RETH[] = {
-* RC_RDMA_READ_REQUEST
-* };
-* static guint32 opCode_AETH[] = {
-* RC_ACKNOWLEDGE
-* }; */
-
-
-/* Field dissector structures.
-* For reserved fields, reservedX denotes the reserved field is X bits in length.
-* e.g. reserved2 is a reserved field 2 bits in length.
-* The third parameter is a filter string associated for this field.
-* So for instance, to filter packets for a given virtual lane,
-* The filter (infiniband.LRH.vl == 3) or something similar would be used. */
-
-static hf_register_info hf[] = {
-
- /* Local Route Header (LRH) */
- {&hf_infiniband_LRH,
- {"Local Route Header", "infiniband.lrh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_virtual_lane,
- {"Virtual Lane", "infiniband.lrh.vl", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_link_version,
- {"Link Version", "infiniband.lrh.lver", FT_UINT8, BASE_DEC, NULL, 0x0F, NULL, HFILL}
- },
- {&hf_infiniband_service_level,
- {"Service Level", "infiniband.lrh.sl", FT_UINT8, BASE_DEC, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_reserved2,
- {"Reserved (2 bits)", "infiniband.lrh.reserved2", FT_UINT8, BASE_DEC, NULL, 0x0C, NULL, HFILL}
- },
- {&hf_infiniband_link_next_header,
- {"Link Next Header", "infiniband.lrh.lnh", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
- },
- {&hf_infiniband_destination_local_id,
- {"Destination Local ID", "infiniband.lrh.dlid", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_reserved5,
- {"Reserved (5 bits)", "infiniband.lrh.reserved5", FT_UINT16, BASE_DEC, NULL, 0xF800, NULL, HFILL}
- },
- {&hf_infiniband_packet_length,
- {"Packet Length", "infiniband.lrh.pktlen", FT_UINT16, BASE_DEC, NULL, 0x07FF, NULL, HFILL}
- },
- {&hf_infiniband_source_local_id,
- {"Source Local ID", "infiniband.lrh.slid", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
-
- /* Global Route Header (GRH) */
- {&hf_infiniband_GRH,
- {"Global Route Header", "infiniband.grh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_ip_version,
- {"IP Version", "infiniband.grh.ipver", FT_UINT8, BASE_DEC, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_traffic_class,
- {"Traffic Class", "infiniband.grh.tclass", FT_UINT16, BASE_DEC, NULL, 0x0FF0, NULL, HFILL}
- },
- {&hf_infiniband_flow_label,
- {"Flow Label", "infiniband.grh.flowlabel", FT_UINT32, BASE_DEC, NULL, 0x000FFFFF, NULL, HFILL}
- },
- {&hf_infiniband_payload_length,
- {"Payload Length", "infiniband.grh.paylen", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_next_header,
- {"Next Header", "infiniband.grh.nxthdr", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_hop_limit,
- {"Hop Limit", "infiniband.grh.hoplmt", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_source_gid,
- {"Source GID", "infiniband.grh.sgid", FT_IPv6, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_destination_gid,
- {"Destination GID", "infiniband.grh.dgid", FT_IPv6, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
-
- /* Base Transport Header (BTH) */
- {&hf_infiniband_BTH,
- {"Base Transport Header", "infiniband.bth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_opcode,
- {"Opcode", "infiniband.bth.opcode", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_solicited_event,
- {"Solicited Event", "infiniband.bth.se", FT_BOOLEAN, BASE_DEC, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_migreq,
- {"MigReq", "infiniband.bth.m", FT_BOOLEAN, BASE_DEC, NULL, 0x40, NULL, HFILL}
- },
- {&hf_infiniband_pad_count,
- {"Pad Count", "infiniband.bth.padcnt", FT_UINT8, BASE_DEC, NULL, 0x30, NULL, HFILL}
- },
- {&hf_infiniband_transport_header_version,
- {"Header Version", "infiniband.bth.tver", FT_UINT8, BASE_DEC, NULL, 0x0F, NULL, HFILL}
- },
- {&hf_infiniband_partition_key,
- {"Partition Key", "infiniband.bth.p_key", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_reserved8,
- {"Reserved (8 bits)", "infiniband.bth.reserved8", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_destination_qp,
- {"Destination Queue Pair", "infiniband.bth.destqp", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_acknowledge_request,
- {"Acknowledge Request", "infiniband.bth.a", FT_BOOLEAN, BASE_DEC, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_reserved7,
- {"Reserved (7 bits)", "infiniband.bth.reserved7", FT_UINT8, BASE_DEC, NULL, 0x7F, NULL, HFILL}
- },
- {&hf_infiniband_packet_sequence_number,
- {"Packet Sequence Number", "infiniband.bth.psn", FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
-
- /* Raw Header (RWH) */
- {&hf_infiniband_RWH,
- {"Raw Header", "infiniband.rwh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_reserved16_RWH,
- {"Reserved (16 bits)", "infiniband.rwh.reserved", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_etype,
- {"Ethertype", "infiniband.rwh.etype", FT_UINT16, BASE_HEX, NULL /*VALS(etype_vals)*/, 0x0, "Type", HFILL }
- },
-
- /* Reliable Datagram Extended Transport Header (RDETH) */
- {&hf_infiniband_RDETH,
- {"Reliable Datagram Extended Transport Header", "infiniband.rdeth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_reserved8_RDETH,
- {"Reserved (8 bits)", "infiniband.rdeth.reserved8", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_ee_context,
- {"E2E Context", "infiniband.rdeth.eecnxt", FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
-
- /* Datagram Extended Transport Header (DETH) */
- {&hf_infiniband_DETH,
- {"Datagram Extended Transport Header", "infiniband.deth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_queue_key,
- {"Queue Key", "infiniband.deth.q_key", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_reserved8_DETH,
- {"Reserved (8 bits)", "infiniband.deth.reserved8", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_source_qp,
- {"Source Queue Pair", "infiniband.deth.srcqp", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
-
- /* RDMA Extended Transport Header (RETH) */
- {&hf_infiniband_RETH,
- {"RDMA Extended Transport Header", "infiniband.reth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_virtual_address,
- {"Virtual Address", "infiniband.reth.va", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_remote_key,
- {"Remote Key", "infiniband.reth.r_key", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_dma_length,
- {"DMA Length", "infiniband.reth.dmalen", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
-
- /* Atomic Extended Transport Header (AtomicETH) */
- {&hf_infiniband_AtomicETH,
- {"Atomic Extended Transport Header", "infiniband.atomiceth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_virtual_address_AtomicETH,
- {"Virtual Address", "infiniband.atomiceth.va", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_remote_key_AtomicETH,
- {"Remote Key", "infiniband.atomiceth.r_key", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_swap_or_add_data,
- {"Swap (Or Add) Data", "infiniband.atomiceth.swapdt", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_compare_data,
- {"Compare Data", "infiniband.atomiceth.cmpdt", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
-
- /* ACK Extended Transport Header (AETH) */
- {&hf_infiniband_AETH,
- {"ACK Extended Transport Header", "infiniband.aeth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_syndrome,
- {"Syndrome", "infiniband.aeth.syndrome", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_message_sequence_number,
- {"Message Sequence Number", "infiniband.aeth.msn", FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
-
- /* Atomic ACK Extended Transport Header (AtomicAckETH) */
- {&hf_infiniband_AtomicAckETH,
- {"Atomic ACK Extended Transport Header", "infiniband.atomicacketh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_original_remote_data,
- {"Original Remote Data", "infiniband.atomicacketh.origremdt", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
- },
- /* Immediate Extended Transport Header (ImmDT) */
- {&hf_infiniband_IMMDT,
- {"Immediate Data", "infiniband.immdt", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
-
- /* Invalidate Extended Transport Header (IETH) */
- {&hf_infiniband_IETH,
- {"RKey", "infiniband.ieth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
-
- /* Payload */
- {&hf_infiniband_payload,
- {"Payload", "infiniband.payload", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_invariant_crc,
- {"Invariant CRC", "infiniband.invariant.crc", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_variant_crc,
- {"Variant CRC", "infiniband.variant.crc", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_raw_data,
- {"Raw Data", "infiniband.rawdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* Unknown or Vendor Specific */
- {&hf_infiniband_vendor,
- {"Unknown/Vendor Specific Data", "infiniband.vendor", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
-
- /* MAD Base Header */
- {&hf_infiniband_MAD,
- {"MAD (Management Datagram) Common Header", "infiniband.mad", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_base_version,
- {"Base Version", "infiniband.mad.baseversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_mgmt_class,
- {"Management Class", "infiniband.mad.mgmtclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_class_version,
- {"Class Version", "infiniband.mad.classversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_reserved1,
- {"Reserved", "infiniband.mad.reserved1", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_method,
- {"Method", "infiniband.mad.method", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
- },
- {&hf_infiniband_status,
- {"Status", "infiniband.mad.status", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_class_specific,
- {"Class Specific", "infiniband.mad.classspecific", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_transaction_id,
- {"Transaction ID", "infiniband.mad.transactionid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_attribute_id,
- {"Attribute ID", "infiniband.mad.attributeid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_reserved16,
- {"Reserved", "infiniband.mad.reserved16", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_attribute_modifier,
- {"Attribute Modifier", "infiniband.mad.attributemodifier", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_data,
- {"MAD Data Payload", "infiniband.mad.data", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* RMPP Header */
- {&hf_infiniband_RMPP,
- {"RMPP (Reliable Multi-Packet Transaction Protocol)", "infiniband.rmpp", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_rmpp_version,
- {"RMPP Type", "infiniband.rmpp.rmppversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_rmpp_type,
- {"RMPP Type", "infiniband.rmpp.rmpptype", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_r_resp_time,
- {"R Resp Time", "infiniband.rmpp.rresptime", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_rmpp_flags,
- {"RMPP Flags", "infiniband.rmpp.rmppflags", FT_UINT8, BASE_HEX, VALS(RMPP_Flags), 0x0F, NULL, HFILL}
- },
- {&hf_infiniband_rmpp_status,
- {"RMPP Status", "infiniband.rmpp.rmppstatus", FT_UINT8, BASE_HEX, VALS(RMPP_Status), 0x0, NULL, HFILL}
- },
- {&hf_infiniband_rmpp_data1,
- {"RMPP Data 1", "infiniband.rmpp.data1", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_rmpp_data2,
- {"RMPP Data 2", "infiniband.rmpp.data2", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* RMPP Data */
- {&hf_infiniband_RMPP_DATA,
- {"RMPP Data (Reliable Multi-Packet Transaction Protocol)", "infiniband.rmpp.data", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_segment_number,
- {"Segment Number", "infiniband.rmpp.segmentnumber", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_payload_length32,
- {"Payload Length", "infiniband.rmpp.payloadlength", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_transferred_data,
- {"Transferred Data", "infiniband.rmpp.transferreddata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* RMPP ACK */
- {&hf_infiniband_new_window_last,
- {"New Window Last", "infiniband.rmpp.newwindowlast", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_reserved220,
- {"Segment Number", "infiniband.rmpp.reserved220", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* RMPP ABORT/STOP */
- {&hf_infiniband_optional_extended_error_data,
- {"Optional Extended Error Data", "infiniband.rmpp.extendederrordata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* SMP Data (LID Routed) */
- {&hf_infiniband_SMP_LID,
- {"Subnet Management Packet (LID Routed)", "infiniband.smplid", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_m_key,
- {"M_Key", "infiniband.smplid.mkey", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_smp_data,
- {"SMP Data", "infiniband.smplid.smpdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_reserved1024,
- {"Reserved (1024 bits)", "infiniband.smplid.reserved1024", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_reserved256,
- {"Reserved (256 bits)", "infiniband.smplid.reserved256", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* SMP Data Directed Route */
- {&hf_infiniband_SMP_DIRECTED,
- {"Subnet Management Packet (Directed Route)", "infiniband.smpdirected", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_smp_status,
- {"Status", "infiniband.smpdirected.smpstatus", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_hop_pointer,
- {"Hop Pointer", "infiniband.smpdirected.hoppointer", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_hop_count,
- {"Hop Count", "infiniband.smpdirected.hopcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_dr_slid,
- {"DrSLID", "infiniband.smpdirected.drslid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_dr_dlid,
- {"DrDLID", "infiniband.smpdirected.drdlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_reserved28,
- {"Reserved (224 bits)", "infiniband.smpdirected.reserved28", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_d,
- {"D (Direction Bit)", "infiniband.smpdirected.d", FT_UINT64, BASE_HEX, NULL, 0x8000, NULL, HFILL}
- },
- {&hf_infiniband_initial_path,
- {"Initial Path", "infiniband.smpdirected.initialpath", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_return_path,
- {"Return Path", "infiniband.smpdirected.returnpath", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* SA MAD Header */
- {&hf_infiniband_SA,
- {"SA Packet (Subnet Administration)", "infiniband.sa.drdlid", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_sm_key,
- {"SM_Key (Verification Key)", "infiniband.sa.smkey", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_attribute_offset,
- {"Attribute Offset", "infiniband.sa.attributeoffset", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_component_mask,
- {"Component Mask", "infiniband.sa.componentmask", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_subnet_admin_data,
- {"Subnet Admin Data", "infiniband.sa.subnetadmindata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* NodeDescription */
- {&hf_infiniband_NodeDescription_NodeString,
- {"NodeString", "infiniband.nodedescription.nodestring", FT_STRING, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* NodeInfo */
- {&hf_infiniband_NodeInfo_BaseVersion,
- {"BaseVersion", "infiniband.nodeinfo.baseversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_NodeInfo_ClassVersion,
- {"ClassVersion", "infiniband.nodeinfo.classversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_NodeInfo_NodeType,
- {"NodeType", "infiniband.nodeinfo.nodetype", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_NodeInfo_NumPorts,
- {"NumPorts", "infiniband.nodeinfo.numports", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_NodeInfo_SystemImageGUID,
- {"SystemImageGUID", "infiniband.nodeinfo.systemimageguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_NodeInfo_NodeGUID,
- {"NodeGUID", "infiniband.nodeinfo.nodeguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_NodeInfo_PortGUID,
- {"PortGUID", "infiniband.nodeinfo.portguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_NodeInfo_PartitionCap,
- {"PartitionCap", "infiniband.nodeinfo.partitioncap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_NodeInfo_DeviceID,
- {"DeviceID", "infiniband.nodeinfo.deviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_NodeInfo_Revision,
- {"Revision", "infiniband.nodeinfo.revision", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_NodeInfo_LocalPortNum,
- {"LocalPortNum", "infiniband.nodeinfo.localportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_NodeInfo_VendorID,
- {"VendorID", "infiniband.nodeinfo.vendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* SwitchInfo */
- {&hf_infiniband_SwitchInfo_LinearFDBCap,
- {"LinearFDBCap", "infiniband.switchinfo.linearfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_RandomFDBCap,
- {"RandomFDBCap", "infiniband.switchinfo.randomfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_MulticastFDBCap,
- {"MulticastFDBCap", "infiniband.switchinfo.multicastfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_LinearFDBTop,
- {"LinearFDBTop", "infiniband.switchinfo.linearfdbtop", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_DefaultPort,
- {"DefaultPort", "infiniband.switchinfo.defaultport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort,
- {"DefaultMulticastPrimaryPort", "infiniband.switchinfo.defaultmulticastprimaryport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort,
- {"DefaultMulticastNotPrimaryPort", "infiniband.switchinfo.defaultmulticastnotprimaryport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_LifeTimeValue,
- {"LifeTimeValue", "infiniband.switchinfo.lifetimevalue", FT_UINT8, BASE_HEX, NULL, 0xF8, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_PortStateChange,
- {"PortStateChange", "infiniband.switchinfo.portstatechange", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming,
- {"OptimizedSLtoVLMappingProgramming", "infiniband.switchinfo.optimizedsltovlmappingprogramming", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_LIDsPerPort,
- {"LIDsPerPort", "infiniband.switchinfo.lidsperport", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_PartitionEnforcementCap,
- {"PartitionEnforcementCap", "infiniband.switchinfo.partitionenforcementcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_InboundEnforcementCap,
- {"InboundEnforcementCap", "infiniband.switchinfo.inboundenforcementcap", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_OutboundEnforcementCap,
- {"OutboundEnforcementCap", "infiniband.switchinfo.outboundenforcementcap", FT_UINT8, BASE_HEX, NULL, 0x40, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_FilterRawInboundCap,
- {"FilterRawInboundCap", "infiniband.switchinfo.filterrawinboundcap", FT_UINT8, BASE_HEX, NULL, 0x20, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_FilterRawOutboundCap,
- {"FilterRawOutboundCap", "infiniband.switchinfo.filterrawoutboundcap", FT_UINT8, BASE_HEX, NULL, 0x10, NULL, HFILL}
- },
- {&hf_infiniband_SwitchInfo_EnhancedPortZero,
- {"EnhancedPortZero", "infiniband.switchinfo.enhancedportzero", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
- },
- /* GUIDInfo */
- {&hf_infiniband_GUIDInfo_GUIDBlock,
- {"GUIDBlock", "infiniband.switchinfo.guidblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_GUIDInfo_GUID,
- {"GUID", "infiniband.switchinfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* PortInfo */
- {&hf_infiniband_PortInfo_M_Key,
- {"M_Key", "infiniband.portinfo.m_key", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_GidPrefix,
- {"GidPrefix", "infiniband.portinfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_LID,
- {"LID", "infiniband.portinfo.lid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_MasterSMLID,
- {"MasterSMLID", "infiniband.portinfo.mastersmlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask,
- {"CapabilityMask", "infiniband.portinfo.capabilitymask", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
-
- /* Capability Mask Flags */
- {&hf_infiniband_PortInfo_CapabilityMask_SM,
- {"SM", "infiniband.portinfo.capabilitymask.issm", FT_UINT32, BASE_HEX, NULL, 0x0000002, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_NoticeSupported,
- {"NoticeSupported", "infiniband.portinfo.capabilitymask.noticesupported", FT_UINT32, BASE_HEX, NULL, 0x0000004, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_TrapSupported,
- {"TrapSupported", "infiniband.portinfo.capabilitymask.trapsupported", FT_UINT32, BASE_HEX, NULL, 0x0000008, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported,
- {"OptionalPDSupported", "infiniband.portinfo.capabilitymask.optionalpdsupported", FT_UINT32, BASE_HEX, NULL, 0x0000010, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported,
- {"AutomaticMigrationSupported", "infiniband.portinfo.capabilitymask.automaticmigrationsupported", FT_UINT32, BASE_HEX, NULL, 0x0000020, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported,
- {"SLMappingSupported", "infiniband.portinfo.capabilitymask.slmappingsupported", FT_UINT32, BASE_HEX, NULL, 0x0000040, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM,
- {"MKeyNVRAM", "infiniband.portinfo.capabilitymask.mkeynvram", FT_UINT32, BASE_HEX, NULL, 0x0000080, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM,
- {"PKeyNVRAM", "infiniband.portinfo.capabilitymask.pkeynvram", FT_UINT32, BASE_HEX, NULL, 0x0000100, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported,
- {"LEDInfoSupported", "infiniband.portinfo.capabilitymask.ledinfosupported", FT_UINT32, BASE_HEX, NULL, 0x0000200, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_SMdisabled,
- {"SMdisabled", "infiniband.portinfo.capabilitymask.smdisabled", FT_UINT32, BASE_HEX, NULL, 0x0000400, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported,
- {"SystemImageGUIDSupported", "infiniband.portinfo.capabilitymask.systemimageguidsupported", FT_UINT32, BASE_HEX, NULL, 0x0000800, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported,
- {"PKeySwitchExternalPortTrapSupported", "infiniband.portinfo.capabilitymask.pkeyswitchexternalporttrapsupported", FT_UINT32, BASE_HEX, NULL, 0x0001000, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported,
- {"CommunicationsManagementSupported", "infiniband.portinfo.capabilitymask.communicationsmanagementsupported", FT_UINT32, BASE_HEX, NULL, 0x0010000, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported,
- {"SNMPTunnelingSupported", "infiniband.portinfo.capabilitymask.snmptunnelingsupported", FT_UINT32, BASE_HEX, NULL, 0x0020000, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_ReinitSupported,
- {"ReinitSupported", "infiniband.portinfo.capabilitymask.reinitsupported", FT_UINT32, BASE_HEX, NULL, 0x0040000, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported,
- {"DeviceManagementSupported", "infiniband.portinfo.capabilitymask.devicemanagementsupported", FT_UINT32, BASE_HEX, NULL, 0x0080000, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported,
- {"VendorClassSupported", "infiniband.portinfo.capabilitymask.vendorclasssupported", FT_UINT32, BASE_HEX, NULL, 0x0100000, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported,
- {"DRNoticeSupported", "infiniband.portinfo.capabilitymask.drnoticesupported", FT_UINT32, BASE_HEX, NULL, 0x0200000, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported,
- {"CapabilityMaskNoticeSupported", "infiniband.portinfo.capabilitymask.capabilitymasknoticesupported", FT_UINT32, BASE_HEX, NULL, 0x0400000, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported,
- {"BootManagementSupported", "infiniband.portinfo.capabilitymask.bootmanagementsupported", FT_UINT32, BASE_HEX, NULL, 0x0800000, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported,
- {"LinkRoundTripLatencySupported", "infiniband.portinfo.capabilitymask.linkroundtriplatencysupported", FT_UINT32, BASE_HEX, NULL, 0x01000000, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported,
- {"ClientRegistrationSupported", "infiniband.portinfo.capabilitymask.clientregistrationsupported", FT_UINT32, BASE_HEX, NULL, 0x02000000, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported,
- {"OtherLocalChangesNoticeSupported", "infiniband.portinfo.capabilitymask.otherlocalchangesnoticesupported", FT_UINT32, BASE_HEX, NULL, 0x04000000, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported,
- {"LinkSpeedWIdthPairsTableSupported", "infiniband.portinfo.capabilitymask.linkspeedwidthpairstablesupported", FT_UINT32, BASE_HEX, NULL, 0x08000000, NULL, HFILL}
- },
- /* End Capability Mask Flags */
-
- {&hf_infiniband_PortInfo_DiagCode,
- {"DiagCode", "infiniband.portinfo.diagcode", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_M_KeyLeasePeriod,
- {"M_KeyLeasePeriod", "infiniband.portinfo.m_keyleaseperiod", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_LocalPortNum,
- {"LocalPortNum", "infiniband.portinfo.localportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_LinkWidthEnabled,
- {"LinkWidthEnabled", "infiniband.portinfo.linkwidthenabled", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_LinkWidthSupported,
- {"LinkWidthSupported", "infiniband.portinfo.linkwidthsupported", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_LinkWidthActive,
- {"LinkWidthActive", "infiniband.portinfo.linkwidthactive", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_LinkSpeedSupported,
- {"LinkSpeedSupported", "infiniband.portinfo.linkspeedsupported", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_PortState,
- {"PortState", "infiniband.portinfo.portstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_PortPhysicalState,
- {"PortPhysicalState", "infiniband.portinfo.portphysicalstate", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_LinkDownDefaultState,
- {"LinkDownDefaultState", "infiniband.portinfo.linkdowndefaultstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_M_KeyProtectBits,
- {"M_KeyProtectBits", "infiniband.portinfo.m_keyprotectbits", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_LMC,
- {"LMC", "infiniband.portinfo.lmc", FT_UINT8, BASE_HEX, NULL, 0x07, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_LinkSpeedActive,
- {"LinkSpeedActive", "infiniband.portinfo.linkspeedactive", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_LinkSpeedEnabled,
- {"LinkSpeedEnabled", "infiniband.portinfo.linkspeedenabled", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_NeighborMTU,
- {"NeighborMTU", "infiniband.portinfo.neighbormtu", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_MasterSMSL,
- {"MasterSMSL", "infiniband.portinfo.mastersmsl", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_VLCap,
- {"VLCap", "infiniband.portinfo.vlcap", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_InitType,
- {"InitType", "infiniband.portinfo.inittype", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_VLHighLimit,
- {"VLHighLimit", "infiniband.portinfo.vlhighlimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_VLArbitrationHighCap,
- {"VLArbitrationHighCap", "infiniband.portinfo.vlarbitrationhighcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_VLArbitrationLowCap,
- {"VLArbitrationLowCap", "infiniband.portinfo.vlarbitrationlowcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_InitTypeReply,
- {"InitTypeReply", "infiniband.portinfo.inittypereply", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_MTUCap,
- {"MTUCap", "infiniband.portinfo.mtucap", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_VLStallCount,
- {"VLStallCount", "infiniband.portinfo.vlstallcount", FT_UINT8, BASE_HEX, NULL, 0xE0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_HOQLife,
- {"HOQLife", "infiniband.portinfo.hoqlife", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_OperationalVLs,
- {"OperationalVLs", "infiniband.portinfo.operationalvls", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_PartitionEnforcementInbound,
- {"PartitionEnforcementInbound", "infiniband.portinfo.partitionenforcementinbound", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_PartitionEnforcementOutbound,
- {"PartitionEnforcementOutbound", "infiniband.portinfo.partitionenforcementoutbound", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_FilterRawInbound,
- {"FilterRawInbound", "infiniband.portinfo.filterrawinbound", FT_UINT8, BASE_HEX, NULL, 0x02, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_FilterRawOutbound,
- {"FilterRawOutbound", "infiniband.portinfo.filterrawoutbound", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_M_KeyViolations,
- {"M_KeyViolations", "infiniband.portinfo.m_keyviolations", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_P_KeyViolations,
- {"P_KeyViolations", "infiniband.portinfo.p_keyviolations", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_Q_KeyViolations,
- {"Q_KeyViolations", "infiniband.portinfo.q_keyviolations", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_GUIDCap,
- {"GUIDCap", "infiniband.portinfo.guidcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_ClientReregister,
- {"ClientReregister", "infiniband.portinfo.clientreregister", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_SubnetTimeOut,
- {"SubnetTimeOut", "infiniband.portinfo.subnettimeout", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_RespTimeValue,
- {"RespTimeValue", "infiniband.portinfo.resptimevalue", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_LocalPhyErrors,
- {"LocalPhyErrors", "infiniband.portinfo.localphyerrors", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_OverrunErrors,
- {"OverrunErrors", "infiniband.portinfo.overrunerrors", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_MaxCreditHint,
- {"MaxCreditHint", "infiniband.portinfo.maxcredithint", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PortInfo_LinkRoundTripLatency,
- {"LinkRoundTripLatency", "infiniband.portinfo.linkroundtriplatency", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* P_KeyTable */
- {&hf_infiniband_P_KeyTable_P_KeyTableBlock,
- {"P_KeyTableBlock", "infiniband.p_keytable.p_keytableblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_P_KeyTable_MembershipType,
- {"MembershipType", "infiniband.p_keytable.membershiptype", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_P_KeyTable_P_KeyBase,
- {"P_KeyBase", "infiniband.p_keytable.p_keybase", FT_UINT16, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
- },
- /* SLtoVLMappingTable */
- {&hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits,
- {"SL(x)toVL", "infiniband.sltovlmappingtable.sltovlhighbits", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits,
- {"SL(x)toVL", "infiniband.sltovlmappingtable.sltovllowbits", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
- },
- /* VLArbitrationTable */
- {&hf_infiniband_VLArbitrationTable_VLWeightPairs,
- {"VLWeightPairs", "infiniband.vlarbitrationtable.vlweightpairs", FT_BYTES, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
- },
- {&hf_infiniband_VLArbitrationTable_VL,
- {"VL", "infiniband.vlarbitrationtable.vl", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
- },
- {&hf_infiniband_VLArbitrationTable_Weight,
- {"Weight", "infiniband.vlarbitrationtable.weight", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* LinearForwardingTable */
- {&hf_infiniband_LinearForwardingTable_LinearForwardingTableBlock,
- {"LinearForwardingTableBlock", "infiniband.linearforwardingtable.linearforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x0F, NULL, HFILL}
- },
- {&hf_infiniband_LinearForwardingTable_Port,
- {"Port", "infiniband.linearforwardingtable.port", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* RandomForwardingTable */
- {&hf_infiniband_RandomForwardingTable_RandomForwardingTableBlock,
- {"RandomForwardingTableBlock", "infiniband.randomforwardingtable.randomforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
- },
- {&hf_infiniband_RandomForwardingTable_LID,
- {"LID", "infiniband.randomforwardingtable.lid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_RandomForwardingTable_Valid,
- {"Valid", "infiniband.randomforwardingtable.valid", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_RandomForwardingTable_LMC,
- {"LMC", "infiniband.randomforwardingtable.lmc", FT_UINT16, BASE_HEX, NULL, 0x70, NULL, HFILL}
- },
- {&hf_infiniband_RandomForwardingTable_Port,
- {"Port", "infiniband.randomforwardingtable.port", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* MulticastForwardingTable */
- {&hf_infiniband_MulticastForwardingTable_MulticastForwardingTableBlock ,
- {"MulticastForwardingTableBlock ", "infiniband.multicastforwardingtable.multicastforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_MulticastForwardingTable_PortMask,
- {"PortMask", "infiniband.multicastforwardingtable.portmask", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* SMInfo */
- {&hf_infiniband_SMInfo_GUID,
- {"GUID", "infiniband.sminfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SMInfo_SM_Key,
- {"SM_Key", "infiniband.sminfo.sm_key", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SMInfo_ActCount,
- {"ActCount", "infiniband.sminfo.actcount", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SMInfo_Priority,
- {"Priority", "infiniband.sminfo.priority", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_SMInfo_SMState,
- {"SMState", "infiniband.sminfo.smstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
- },
- /* VendorDiag */
- {&hf_infiniband_VendorDiag_NextIndex,
- {"NextIndex", "infiniband.vendordiag.nextindex", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_VendorDiag_DiagData,
- {"DiagData", "infiniband.vendordiag.diagdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* LedInfo */
- {&hf_infiniband_LedInfo_LedMask,
- {"LedMask", "infiniband.ledinfo.ledmask", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- /* LinkSpeedWidthPairsTable */
- {&hf_infiniband_LinkSpeedWidthPairsTable_NumTables,
- {"NumTables", "infiniband.linkspeedwidthpairstable.numtables", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_LinkSpeedWidthPairsTable_PortMask,
- {"PortMask", "infiniband.linkspeedwidthpairstable.portmask", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive,
- {"Speed 2.5 Gbps", "infiniband.linkspeedwidthpairstable.speedtwofive", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive,
- {"Speed 5 Gbps", "infiniband.linkspeedwidthpairstable.speedfive", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen,
- {"Speed 10 Gbps", "infiniband.linkspeedwidthpairstable.speedten", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- /* NodeRecord */
- /* PortInfoRecord */
- /* SLtoVLMappingTableRecord */
- /* SwitchInfoRecord */
- /* LinearForwardingTableRecord */
- /* RandomForwardingTableRecord */
- /* MulticastForwardingTableRecord */
- /* VLArbitrationTableRecord */
- {&hf_infiniband_SA_LID,
- {"LID", "infiniband.sa.lid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SA_EndportLID,
- {"EndportLID", "infiniband.sa.endportlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SA_PortNum,
- {"PortNum", "infiniband.sa.portnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SA_InputPortNum ,
- {"InputPortNum ", "infiniband.sa.inputportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SA_OutputPortNum,
- {"OutputPortNum", "infiniband.sa.outputportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SA_BlockNum_EightBit,
- {"BlockNum_EightBit", "infiniband.sa.blocknum_eightbit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SA_BlockNum_NineBit,
- {"BlockNum_NineBit", "infiniband.sa.blocknum_ninebit", FT_UINT16, BASE_HEX, NULL, 0x01FF, NULL, HFILL}
- },
- {&hf_infiniband_SA_BlockNum_SixteenBit,
- {"BlockNum_SixteenBit", "infiniband.sa.blocknum_sixteenbit", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_SA_Position,
- {"Position", "infiniband.sa.position", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_SA_Index,
- {"Index", "infiniband.sa.index", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* InformInfoRecord */
- {&hf_infiniband_InformInfoRecord_SubscriberGID,
- {"SubscriberGID", "infiniband.informinforecord.subscribergid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_InformInfoRecord_Enum,
- {"Enum", "infiniband.informinforecord.enum", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* InformInfo */
- {&hf_infiniband_InformInfo_GID,
- {"GID", "infiniband.informinfo.gid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_InformInfo_LIDRangeBegin,
- {"LIDRangeBegin", "infiniband.informinfo.lidrangebegin", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_InformInfo_LIDRangeEnd,
- {"LIDRangeEnd", "infiniband.informinfo.lidrangeend", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_InformInfo_IsGeneric,
- {"IsGeneric", "infiniband.informinfo.isgeneric", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_InformInfo_Subscribe,
- {"Subscribe", "infiniband.informinfo.subscribe", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_InformInfo_Type,
- {"Type", "infiniband.informinfo.type", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_InformInfo_TrapNumberDeviceID,
- {"TrapNumberDeviceID", "infiniband.informinfo.trapnumberdeviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_InformInfo_QPN,
- {"QPN", "infiniband.informinfo.qpn", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_InformInfo_RespTimeValue,
- {"RespTimeValue", "infiniband.informinfo.resptimevalue", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
- },
- {&hf_infiniband_InformInfo_ProducerTypeVendorID,
- {"ProducerTypeVendorID", "infiniband.informinfo.producertypevendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* LinkRecord */
- {&hf_infiniband_LinkRecord_FromLID,
- {"FromLID", "infiniband.linkrecord.fromlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_LinkRecord_FromPort,
- {"FromPort", "infiniband.linkrecord.fromport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_LinkRecord_ToPort,
- {"ToPort", "infiniband.linkrecord.toport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_LinkRecord_ToLID,
- {"ToLID", "infiniband.linkrecord.tolid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* ServiceRecord */
- {&hf_infiniband_ServiceRecord_ServiceID,
- {"ServiceID", "infiniband.linkrecord.serviceid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_ServiceRecord_ServiceGID,
- {"ServiceGID", "infiniband.linkrecord.servicegid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_ServiceRecord_ServiceP_Key,
- {"ServiceP_Key", "infiniband.linkrecord.servicep_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_ServiceRecord_ServiceLease,
- {"ServiceLease", "infiniband.linkrecord.servicelease", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_ServiceRecord_ServiceKey,
- {"ServiceKey", "infiniband.linkrecord.servicekey", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_ServiceRecord_ServiceName,
- {"ServiceName", "infiniband.linkrecord.servicename", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_ServiceRecord_ServiceData,
- {"ServiceData", "infiniband.linkrecord.servicedata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* ServiceAssociationRecord */
- {&hf_infiniband_ServiceAssociationRecord_ServiceKey,
- {"ServiceKey", "infiniband.serviceassociationrecord.servicekey", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_ServiceAssociationRecord_ServiceName,
- {"ServiceName", "infiniband.serviceassociationrecord.servicename", FT_STRING, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* PathRecord */
- {&hf_infiniband_PathRecord_DGID,
- {"DGID", "infiniband.pathrecord.dgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_SGID,
- {"SGID", "infiniband.pathrecord.sgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_DLID,
- {"DLID", "infiniband.pathrecord.dlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_SLID,
- {"SLID", "infiniband.pathrecord.slid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_RawTraffic,
- {"RawTraffic", "infiniband.pathrecord.rawtraffic", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_FlowLabel,
- {"FlowLabel", "infiniband.pathrecord.flowlabel", FT_UINT24, BASE_HEX, NULL, 0xFFFFF0, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_HopLimit,
- {"HopLimit", "infiniband.pathrecord.hoplimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_TClass,
- {"TClass", "infiniband.pathrecord.tclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_Reversible,
- {"Reversible", "infiniband.pathrecord.reversible", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_NumbPath,
- {"NumbPath", "infiniband.pathrecord.numbpath", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_P_Key,
- {"P_Key", "infiniband.pathrecord.p_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_SL,
- {"SL", "infiniband.pathrecord.sl", FT_UINT16, BASE_HEX, NULL, 0x000F, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_MTUSelector,
- {"MTUSelector", "infiniband.pathrecord.mtuselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_MTU,
- {"MTU", "infiniband.pathrecord.mtu", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_RateSelector,
- {"RateSelector", "infiniband.pathrecord.rateselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_Rate,
- {"Rate", "infiniband.pathrecord.rate", FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_PacketLifeTimeSelector,
- {"PacketLifeTimeSelector", "infiniband.pathrecord.packetlifetimeselector", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_PacketLifeTime,
- {"PacketLifeTime", "infiniband.pathrecord.packetlifetime", FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL}
- },
- {&hf_infiniband_PathRecord_Preference,
- {"Preference", "infiniband.pathrecord.preference", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* MCMemberRecord */
- {&hf_infiniband_MCMemberRecord_MGID,
- {"MGID", "infiniband.mcmemberrecord.mgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_PortGID,
- {"PortGID", "infiniband.mcmemberrecord.portgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_Q_Key,
- {"Q_Key", "infiniband.mcmemberrecord.q_key", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_MLID,
- {"MLID", "infiniband.mcmemberrecord.mlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_MTUSelector,
- {"MTUSelector", "infiniband.mcmemberrecord.mtuselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_MTU,
- {"MTU", "infiniband.mcmemberrecord.mtu", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_TClass,
- {"TClass", "infiniband.mcmemberrecord.tclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_P_Key,
- {"P_Key", "infiniband.mcmemberrecord.p_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_RateSelector,
- {"RateSelector", "infiniband.mcmemberrecord.rateselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_Rate,
- {"Rate", "infiniband.mcmemberrecord.rate", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_PacketLifeTimeSelector,
- {"PacketLifeTimeSelector", "infiniband.mcmemberrecord.packetlifetimeselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_PacketLifeTime,
- {"PacketLifeTime", "infiniband.mcmemberrecord.packetlifetime", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_SL,
- {"SL", "infiniband.mcmemberrecord.sl", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_FlowLabel,
- {"FlowLabel", "infiniband.mcmemberrecord.flowlabel", FT_UINT24, BASE_HEX, NULL, 0x0FFFFF, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_HopLimit,
- {"HopLimit", "infiniband.mcmemberrecord.hoplimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_Scope,
- {"Scope", "infiniband.mcmemberrecord.scope", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_JoinState,
- {"JoinState", "infiniband.mcmemberrecord.joinstate", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
- },
- {&hf_infiniband_MCMemberRecord_ProxyJoin,
- {"ProxyJoin", "infiniband.mcmemberrecord.proxyjoin", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
- },
- /* MultiPathRecord */
- {&hf_infiniband_MultiPathRecord_RawTraffic,
- {"RawTraffic", "infiniband.multipathrecord.rawtraffic", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_FlowLabel,
- {"FlowLabel", "infiniband.multipathrecord.flowlabel", FT_UINT24, BASE_HEX, NULL, 0x0FFFFF, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_HopLimit,
- {"HopLimit", "infiniband.multipathrecord.hoplimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_TClass,
- {"TClass", "infiniband.multipathrecord.tclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_Reversible,
- {"Reversible", "infiniband.multipathrecord.reversible", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_NumbPath,
- {"NumbPath", "infiniband.multipathrecord.numbpath", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_P_Key,
- {"P_Key", "infiniband.multipathrecord.p_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_SL,
- {"SL", "infiniband.multipathrecord.sl", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_MTUSelector,
- {"MTUSelector", "infiniband.multipathrecord.mtuselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_MTU,
- {"MTU", "infiniband.multipathrecord.mtu", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_RateSelector,
- {"RateSelector", "infiniband.multipathrecord.rateselector", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_Rate,
- {"Rate", "infiniband.multipathrecord.rate", FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_PacketLifeTimeSelector,
- {"PacketLifeTimeSelector", "infiniband.multipathrecord.packetlifetimeselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_PacketLifeTime,
- {"PacketLifeTime", "infiniband.multipathrecord.packetlifetime", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_IndependenceSelector,
- {"IndependenceSelector", "infiniband.multipathrecord.independenceselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_GIDScope,
- {"GIDScope", "infiniband.multipathrecord.gidscope", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_SGIDCount,
- {"SGIDCount", "infiniband.multipathrecord.sgidcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_DGIDCount,
- {"DGIDCount", "infiniband.multipathrecord.dgidcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_MultiPathRecord_SDGID,
- {"SDGID", "infiniband.multipathrecord.sdgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* Notice */
- {&hf_infiniband_Notice_IsGeneric,
- {"IsGeneric", "infiniband.notice.isgeneric", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_Notice_Type,
- {"Type", "infiniband.notice.type", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
- },
- {&hf_infiniband_Notice_ProducerTypeVendorID,
- {"ProducerTypeVendorID", "infiniband.notice.producertypevendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_Notice_TrapNumberDeviceID,
- {"TrapNumberDeviceID", "infiniband.notice.trapnumberdeviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_Notice_IssuerLID,
- {"IssuerLID", "infiniband.notice.issuerlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_Notice_NoticeToggle,
- {"NoticeToggle", "infiniband.notice.noticetoggle", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_Notice_NoticeCount,
- {"NoticeCount", "infiniband.notice.noticecount", FT_UINT16, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
- },
- {&hf_infiniband_Notice_DataDetails,
- {"DataDetails", "infiniband.notice.datadetails", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_Notice_IssuerGID,
- {"IssuerGID", "infiniband.notice.issuergid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_Notice_ClassTrapSpecificData,
- {"ClassTrapSpecificData", "infiniband.notice.classtrapspecificdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* Traps 64,65,66,67 */
- {&hf_infiniband_Trap_GIDADDR,
- {"GIDADDR", "infiniband.trap.gidaddr", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* Traps 68,69 */
- {&hf_infiniband_Trap_COMP_MASK,
- {"COMP_MASK", "infiniband.trap.comp_mask", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_Trap_WAIT_FOR_REPATH,
- {"WAIT_FOR_REPATH", "infiniband.trap.wait_for_repath", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
- },
- {&hf_infiniband_Trap_PATH_REC,
- {"PATH_REC", "infiniband.trap.path_rec", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* Trap 128 */
- {&hf_infiniband_Trap_LIDADDR,
- {"LIDADDR", "infiniband.trap.lidaddr", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* Trap 129, 130, 131 */
- {&hf_infiniband_Trap_PORTNO,
- {"PORTNO", "infiniband.trap.portno", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- /* Trap 144 */
- {&hf_infiniband_Trap_OtherLocalChanges,
- {"OtherLocalChanges", "infiniband.trap.otherlocalchanges", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_CAPABILITYMASK,
- {"CAPABILITYMASK", "infiniband.trap.capabilitymask", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
- },
- {&hf_infiniband_Trap_LinkSpeecEnabledChange,
- {"LinkSpeecEnabledChange", "infiniband.trap.linkspeecenabledchange", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
- },
- {&hf_infiniband_Trap_LinkWidthEnabledChange,
- {"LinkWidthEnabledChange", "infiniband.trap.linkwidthenabledchange", FT_UINT8, BASE_HEX, NULL, 0x02, NULL, HFILL}
- },
- {&hf_infiniband_Trap_NodeDescriptionChange,
- {"NodeDescriptionChange", "infiniband.trap.nodedescriptionchange", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- /* Trap 145 */
- {&hf_infiniband_Trap_SYSTEMIMAGEGUID,
- {"SYSTEMIMAGEGUID", "infiniband.trap.systemimageguid", FT_UINT64, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- /* Trap 256 */
- {&hf_infiniband_Trap_DRSLID,
- {"DRSLID", "infiniband.trap.drslid", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_METHOD,
- {"METHOD", "infiniband.trap.method", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_ATTRIBUTEID,
- {"ATTRIBUTEID", "infiniband.trap.attributeid", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_ATTRIBUTEMODIFIER,
- {"ATTRIBUTEMODIFIER", "infiniband.trap.attributemodifier", FT_UINT32, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_MKEY,
- {"MKEY", "infiniband.trap.mkey", FT_UINT64, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_DRNotice,
- {"DRNotice", "infiniband.trap.drnotice", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_DRPathTruncated,
- {"DRPathTruncated", "infiniband.trap.drpathtruncated", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_DRHopCount,
- {"DRHopCount", "infiniband.trap.drhopcount", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_DRNoticeReturnPath,
- {"DRNoticeReturnPath", "infiniband.trap.drnoticereturnpath", FT_BYTES, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- /* Trap 257, 258 */
- {&hf_infiniband_Trap_LIDADDR1,
- {"LIDADDR1", "infiniband.trap.lidaddr1", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_LIDADDR2,
- {"LIDADDR2", "infiniband.trap.lidaddr2", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_KEY,
- {"KEY", "infiniband.trap.key", FT_UINT32, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_SL,
- {"SL", "infiniband.trap.sl", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_QP1,
- {"QP1", "infiniband.trap.qp1", FT_UINT24, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_QP2,
- {"QP2", "infiniband.trap.qp2", FT_UINT24, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_GIDADDR1,
- {"GIDADDR1", "infiniband.trap.gidaddr1", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_GIDADDR2,
- {"GIDADDR2", "infiniband.trap.gidaddr2", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- /* Trap 259 */
- {&hf_infiniband_Trap_DataValid,
- {"DataValid", "infiniband.trap.datavalid", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_PKEY,
- {"PKEY", "infiniband.trap.pkey", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
- },
- {&hf_infiniband_Trap_SWLIDADDR,
- {"SWLIDADDR", "infiniband.trap.swlidaddr", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL}
- }
-};
-
-/* Array to hold expansion options between dissections */
-static gint *ett[] = {
- &ett_infiniband,
- &ett_all_headers,
- &ett_lrh,
- &ett_grh,
- &ett_bth,
- &ett_rwh,
- &ett_rawdata,
- &ett_rdeth,
- &ett_deth,
- &ett_reth,
- &ett_atomiceth,
- &ett_aeth,
- &ett_atomicacketh,
- &ett_immdt,
- &ett_ieth,
- &ett_payload,
- &ett_vendor,
- &ett_subn_lid_routed,
- &ett_subn_directed_route,
- &ett_subnadmin,
- &ett_mad,
- &ett_rmpp,
- &ett_subm_attribute,
- &ett_suba_attribute,
- &ett_datadetails,
- &ett_noticestraps,
- &ett_nodedesc,
- &ett_nodeinfo,
- &ett_switchinfo,
- &ett_guidinfo,
- &ett_portinfo,
- &ett_portinfo_capmask,
- &ett_pkeytable,
- &ett_sltovlmapping,
- &ett_vlarbitrationtable,
- &ett_linearforwardingtable,
- &ett_randomforwardingtable,
- &ett_multicastforwardingtable,
- &ett_sminfo,
- &ett_vendordiag,
- &ett_ledinfo,
- &ett_linkspeedwidthpairs,
- &ett_informinfo,
- &ett_linkrecord,
- &ett_servicerecord,
- &ett_pathrecord,
- &ett_mcmemberrecord,
- &ett_tracerecord,
- &ett_multipathrecord,
- &ett_serviceassocrecord
-};
-
-
-#endif
diff --git a/plugins/infiniband/plugin.rc.in b/plugins/infiniband/plugin.rc.in
deleted file mode 100644
index 8cb960fe82..0000000000
--- a/plugins/infiniband/plugin.rc.in
+++ /dev/null
@@ -1,34 +0,0 @@
-#include "winver.h"
-
-VS_VERSION_INFO VERSIONINFO
- FILEVERSION @RC_MODULE_VERSION@
- PRODUCTVERSION @RC_VERSION@
- FILEFLAGSMASK 0x0L
-#ifdef _DEBUG
- FILEFLAGS VS_FF_DEBUG
-#else
- FILEFLAGS 0
-#endif
- FILEOS VOS_NT_WINDOWS32
- FILETYPE VFT_DLL
-BEGIN
- BLOCK "StringFileInfo"
- BEGIN
- BLOCK "040904b0"
- BEGIN
- VALUE "CompanyName", "Endace Technology Limited, http://www.endace.com/\0"
- VALUE "FileDescription", "@PACKAGE@ dissector\0"
- VALUE "FileVersion", "@MODULE_VERSION@\0"
- VALUE "InternalName", "@PACKAGE@ @MODULE_VERSION@\0"
- VALUE "LegalCopyright", "Copyright © 2008 Endace Technology Limited\0"
- VALUE "OriginalFilename", "@PLUGIN_NAME@.dll\0"
- VALUE "ProductName", "Wireshark\0"
- VALUE "ProductVersion", "@VERSION@\0"
- VALUE "Comments", "Build with @MSVC_VARIANT@\0"
- END
- END
- BLOCK "VarFileInfo"
- BEGIN
- VALUE "Translation", 0x409, 1200
- END
-END